gimp/app/widgets
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
..
.cvsignore app/widgets/Makefile.am use gimp_mkenums to create widgets-enums.c, added 2002-03-18 22:26:41 +00:00
Makefile.am themes/Default/images/Makefile.am removed ... 2004-08-04 18:15:41 +00:00
gimpaction.c libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def 2004-07-27 16:39:00 +00:00
gimpaction.h app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gimpactionfactory.c Enabled disabling all menu mnemonics. Addresses bug #120034: 2004-07-27 22:17:30 +00:00
gimpactionfactory.h Enabled disabling all menu mnemonics. Addresses bug #120034: 2004-07-27 22:17:30 +00:00
gimpactiongroup.c forgot to strip mnemonics here. 2004-07-27 22:38:40 +00:00
gimpactiongroup.h Enabled disabling all menu mnemonics. Addresses bug #120034: 2004-07-27 22:17:30 +00:00
gimpactionview.c rephrased the text for the dialog that appears if a new shortcut collides 2004-07-22 12:42:57 +00:00
gimpactionview.h app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gimpblobeditor.c themes/Default/images/Makefile.am removed ... 2004-08-04 18:15:41 +00:00
gimpblobeditor.h themes/Default/images/Makefile.am removed ... 2004-08-04 18:15:41 +00:00
gimpbrusheditor.c themes/Default/images/Makefile.am removed ... 2004-08-04 18:15:41 +00:00
gimpbrusheditor.h Added optional spikes for the generated brushes, enabling star shaped 2004-08-01 17:20:00 +00:00
gimpbrushfactoryview.c added action_data_get_context() and macro return_if_no_context(). 2004-05-11 16:05:21 +00:00
gimpbrushfactoryview.h app/widgets/gimpbrushfactoryview.[ch] app/widgets/gimpbufferview.[ch] 2003-04-08 12:39:02 +00:00
gimpbrushselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpbrushselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpbufferview.c added a preview of the global buffer. 2004-07-12 20:25:05 +00:00
gimpbufferview.h added a preview of the global buffer. 2004-07-12 20:25:05 +00:00
gimpcellrendereraccel.c app/core/gimpmarshal.list added "gboolean delete" parameter to the 2004-07-21 14:09:36 +00:00
gimpcellrendereraccel.h app/core/gimpmarshal.list added "gboolean delete" parameter to the 2004-07-21 14:09:36 +00:00
gimpcellrendererviewable.c app/widgets/widgets-enums.h New function 2004-03-13 16:54:35 +00:00
gimpcellrendererviewable.h app/widgets/gimpcellrenderertoggle.[ch] added public functions to emit the 2003-03-19 15:17:13 +00:00
gimpchanneltreeview.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimpchanneltreeview.h Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 11:14:29 +00:00
gimpclipboard.c added a "const gchar *format" parameter to 2004-07-08 11:27:48 +00:00
gimpclipboard.h changed to allow pasting any GdkPixbuf supported format (makes pasting 2004-07-07 16:02:23 +00:00
gimpcolorbar.c removed GIMP_TYPE_COLOR. 2004-07-26 19:56:47 +00:00
gimpcolorbar.h put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimpcolordialog.c app/display/gimpdisplayshell-layer-select.c app/display/gimpprogress.c 2004-05-26 13:39:23 +00:00
gimpcolordialog.h removed color_notebook_new() and renamed color_notebook_viewable_new() to 2003-11-10 17:55:44 +00:00
gimpcolordisplayeditor.c modules/cdisplay_gamma.c added object properties for configurable values. 2004-07-04 00:21:03 +00:00
gimpcolordisplayeditor.h libgimpwidgets/gimpwidgetsmarshal.list added signals ::added(), 2003-11-22 15:54:12 +00:00
gimpcoloreditor.c added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND }, 2004-05-27 12:41:22 +00:00
gimpcoloreditor.h added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND }, 2004-05-27 12:41:22 +00:00
gimpcolorframe.c app/display/gimpdisplayshell-layer-select.c app/display/gimpprogress.c 2004-05-26 13:39:23 +00:00
gimpcolorframe.h app/config/gimpconfigwriter.c app/core/gimpstrokeoptions.c 2004-05-24 14:51:15 +00:00
gimpcolormapeditor.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimpcolormapeditor.h Cleaned up all places which pick colors to work consistently: the concept 2003-09-26 13:33:54 +00:00
gimpcolorpanel.c Bill Skaggs <weskaggs@primate.ucdavis.edu> 2004-06-23 22:44:04 +00:00
gimpcolorpanel.h app/config/gimpconfigwriter.c app/core/gimpstrokeoptions.c 2004-05-24 14:51:15 +00:00
gimpcomponenteditor.c app/widgets/Makefile.am moved to libgimpwidgets. 2004-07-26 21:09:16 +00:00
gimpcomponenteditor.h added a GimpItemFactory to the GimpEditor struct. Added 2003-03-21 11:47:37 +00:00
gimpcontainerbox.c added "preview-size" and "preview-border-width" properties. Cleanup. 2004-05-28 10:49:56 +00:00
gimpcontainerbox.h app/widgets/gimpchanneltreeview.c app/widgets/gimpcontainerbox.[ch] 2004-05-11 10:01:25 +00:00
gimpcontainercombobox.c added "preview-size" and "preview-border-width" properties. Cleanup. 2004-05-28 10:49:56 +00:00
gimpcontainercombobox.h app/widgets/Makefile.am app/widgets/widgets-types.h added new widget, 2004-05-11 12:13:31 +00:00
gimpcontainereditor.c app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpcontainereditor.h app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpcontainerentry.c export the column enum. 2004-05-31 20:44:18 +00:00
gimpcontainerentry.h export the column enum. 2004-05-31 20:44:18 +00:00
gimpcontainergridview.c ref/unref the view around the calls to gimp_container_view_item_selected() 2004-08-03 14:55:31 +00:00
gimpcontainergridview.h app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpcontainerpopup.c app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpcontainerpopup.h app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpcontainertreeview-dnd.c app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimpcontainertreeview-dnd.h Allow all sorts of things to be dropped on or in between the items of a 2004-06-28 22:07:12 +00:00
gimpcontainertreeview.c app/widgets/Makefile.am moved to libgimpwidgets. 2004-07-26 21:09:16 +00:00
gimpcontainertreeview.h app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimpcontainerview-utils.c derive it from GtkBin, not from GtkVBox. Removed "content_spacing" style 2003-04-11 16:51:49 +00:00
gimpcontainerview-utils.h added vitrual function GimpViewable::get_description() which returns the 2003-04-08 16:01:01 +00:00
gimpcontainerview.c create the hash table when inserting items; removes redundant 2004-06-02 12:49:16 +00:00
gimpcontainerview.h added "preview-size" and "preview-border-width" properties. Cleanup. 2004-05-28 10:49:56 +00:00
gimpcontrollerinfo.c added a boolean property "debug-events" and honor it when printing 2004-06-24 22:35:00 +00:00
gimpcontrollerinfo.h added a boolean property "debug-events" and honor it when printing 2004-06-24 22:35:00 +00:00
gimpcontrollerkeyboard.c app/tools/gimptool.[ch] added boolean return value to 2004-06-24 10:16:08 +00:00
gimpcontrollerkeyboard.h app/tools/gimptool.[ch] added boolean return value to 2004-06-24 10:16:08 +00:00
gimpcontrollers.c app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gimpcontrollers.h app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gimpcontrollerwheel.c renamed function gimp_controller_wheel_scrolled() to 2004-06-24 15:29:19 +00:00
gimpcontrollerwheel.h renamed function gimp_controller_wheel_scrolled() to 2004-06-24 15:29:19 +00:00
gimpcursor.c removed value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job 2004-06-21 16:17:16 +00:00
gimpcursor.h added enum GimpCursorFormat which can be one of { BITMAP, PIXBUF, 2004-06-13 02:08:54 +00:00
gimpdasheditor.c Applied a bunch of AIX portability fixes (bug #148813): 2004-07-30 00:57:22 +00:00
gimpdasheditor.h removed static variables, don't use GIMP_CONFIG_INSTALL_PROP_FOO() for 2004-02-19 16:42:24 +00:00
gimpdataeditor.c added help IDs to all actions representing the toplevel popups and menus 2004-05-02 08:56:07 +00:00
gimpdataeditor.h app/widgets/Makefile.am app/widgets/widgets-types.h new GtkUIManager 2004-04-21 16:33:17 +00:00
gimpdatafactoryview.c app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpdatafactoryview.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpdataselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpdataselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpdeviceinfo.c app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c 2004-07-04 21:27:09 +00:00
gimpdeviceinfo.h override GObjectClass->constructor() and do the setup stuff there, not in 2002-05-28 16:41:56 +00:00
gimpdevices.c Enabled the various "Clear saved foobar now" buttons in prefs: 2004-07-21 16:11:31 +00:00
gimpdevices.h Enabled the various "Clear saved foobar now" buttons in prefs: 2004-07-21 16:11:31 +00:00
gimpdevicestatus.c Enabled the various "Clear saved foobar now" buttons in prefs: 2004-07-21 16:11:31 +00:00
gimpdevicestatus.h app/gui/Makefile.am removed... 2003-07-07 13:37:19 +00:00
gimpdialogfactory.c set/unset the busy cursor on all windows which have widget->window, not 2004-07-12 11:47:54 +00:00
gimpdialogfactory.h made enum GimpDialogVisibilityState and GIMP_DIALOG_VISIBILITY_KEY public. 2004-03-13 18:19:46 +00:00
gimpdnd.c app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimpdnd.h app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimpdock.c new function which overrides GtkWindow's default handler in order to give 2004-05-03 14:57:19 +00:00
gimpdock.h added GimpWindowTypeHint enum. 2003-11-20 20:36:55 +00:00
gimpdockable.c app/display/gimpdisplayshell-scale.c app/gui/info-window.c 2004-06-02 17:56:02 +00:00
gimpdockable.h added a horrible hack that sets the paned's position after the first 2004-06-01 12:31:44 +00:00
gimpdockbook.c app/actions/file-actions.c remove "file-close" action and callback... 2004-05-05 11:40:20 +00:00
gimpdockbook.h added help IDs to all actions representing the toplevel popups and menus 2004-05-02 08:56:07 +00:00
gimpdocked.c reoedered to somehow reflect the class hierarchy. 2004-05-23 10:04:41 +00:00
gimpdocked.h reoedered to somehow reflect the class hierarchy. 2004-05-23 10:04:41 +00:00
gimpdocumentview.c app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimpdocumentview.h app/actions/documents-actions.c app/actions/documents-commands.c 2004-05-12 18:36:33 +00:00
gimpdrawabletreeview.c added GimpContext parameters to GimpActivateItemFunc, GimpNewItemFunc and 2004-05-25 14:37:02 +00:00
gimpdrawabletreeview.h removed "visible" and all its API... 2003-09-11 19:52:29 +00:00
gimpeditor.c put the image popup menu into a dummy menubar to work around the silly 2004-05-17 13:38:03 +00:00
gimpeditor.h put the image popup menu into a dummy menubar to work around the silly 2004-05-17 13:38:03 +00:00
gimpenumaction.c app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimpenumaction.h app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimpenumcombobox.c libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h 2004-04-20 19:06:37 +00:00
gimpenumcombobox.h libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h 2004-04-20 19:06:37 +00:00
gimpenumstore.c always do the check for perl and use the substituted perl executable name 2004-07-30 20:42:53 +00:00
gimpenumstore.h libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h 2004-04-20 19:06:37 +00:00
gimpenumwidgets.c removed enums GimpImageType and GimpImageBaseType ... 2004-07-29 12:33:15 +00:00
gimpenumwidgets.h app/widgets/Makefile.am app/widgets/widgets-types.h removed GimpEnumMenu. 2004-04-18 15:12:42 +00:00
gimperrorconsole.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimperrorconsole.h added missing cast. 2004-02-26 20:04:20 +00:00
gimpfgbgeditor.c implement GtkWidget::drag_motion() and set the FG/BG depending on where 2004-07-01 10:42:00 +00:00
gimpfgbgeditor.h implement GtkWidget::drag_motion() and set the FG/BG depending on where 2004-07-01 10:42:00 +00:00
gimpfiledialog.c string change. 2004-07-27 12:41:44 +00:00
gimpfiledialog.h app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that 2004-07-16 21:24:39 +00:00
gimpfileprocview.c added the removed help IDs back. 2004-07-17 19:53:05 +00:00
gimpfileprocview.h added the removed help IDs back. 2004-07-17 19:53:05 +00:00
gimpfontselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpfontselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpfontview.c app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpfontview.h added gimp_container_freeze() / _thaw() around font list reloading. 2003-10-18 16:23:15 +00:00
gimpgradienteditor.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimpgradienteditor.h applied a patch from David Gowers that makes the gradient editor display 2004-06-05 11:14:38 +00:00
gimpgradientselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpgradientselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimpgrideditor.c added gimp_prop_label_new(). 2004-06-24 22:23:05 +00:00
gimpgrideditor.h removed "grid_changed" signal. The user of GimpGridEditor can connect to 2003-10-14 12:23:23 +00:00
gimphelp-ids.h app/widgets/gimphelp-ids.h removed unused help IDs GIMP_HELP_FILE_OPEN_XCF 2004-07-27 12:28:30 +00:00
gimphelp.c print the help-id and help-domain to stdout if gimp was started with the 2004-07-27 11:19:33 +00:00
gimphelp.h Removed any remaining GUI dependency from the PDB wrappers: 2004-07-10 20:29:11 +00:00
gimphistogrambox.c removed the label between the spinbuttons, it looks silly. Converted tabs 2004-06-20 22:04:10 +00:00
gimphistogrambox.h removed the label between the spinbuttons, it looks silly. Converted tabs 2004-06-20 22:04:10 +00:00
gimphistogrameditor.c reverted my last change. (gimp_histogram_editor_item_visible): fix the 2004-07-08 22:45:36 +00:00
gimphistogrameditor.h Replaced the histogram tool by a histogram dialog: 2003-11-01 02:39:34 +00:00
gimphistogramview.c fixed a drawing bug I introduced earlier today. 2004-07-07 01:59:33 +00:00
gimphistogramview.h draw the selection in GTK_STATE_SELECTED's colors, not inverted. Fixed 2003-12-15 17:40:31 +00:00
gimpimagedock.c correctly get the default GimpContainerViewInterface implementation and 2004-05-11 16:01:00 +00:00
gimpimagedock.h correctly get the default GimpContainerViewInterface implementation and 2004-05-11 16:01:00 +00:00
gimpimageeditor.c reoedered to somehow reflect the class hierarchy. 2004-05-23 10:04:41 +00:00
gimpimageeditor.h reoedered to somehow reflect the class hierarchy. 2004-05-23 10:04:41 +00:00
gimpimageview.c app/widgets/gimpcontainergridview.[ch] removed "reorderable" from 2004-05-28 09:52:15 +00:00
gimpimageview.h added action_data_get_context() and macro return_if_no_context(). 2004-05-11 16:05:21 +00:00
gimpitemfactory.c app/config/gimpconfig-deserialize.c app/config/gimpscanner.c 2004-05-12 08:13:33 +00:00
gimpitemfactory.h added help IDs to all actions representing the toplevel popups and menus 2004-05-02 08:56:07 +00:00
gimpitemtreeview.c new function which checks if undo compression is possible: 2004-08-03 14:09:49 +00:00
gimpitemtreeview.h added GimpContext parameters to GimpActivateItemFunc, GimpNewItemFunc and 2004-05-25 14:37:02 +00:00
gimplayertreeview.c #include "core/gimpimage-undo.h" 2004-08-04 10:15:49 +00:00
gimplayertreeview.h display the floating selection's name in italic letters. Added the bold 2003-09-06 21:17:16 +00:00
gimpmenudock.c correctly get the default GimpContainerViewInterface implementation and 2004-05-11 16:01:00 +00:00
gimpmenudock.h correctly get the default GimpContainerViewInterface implementation and 2004-05-11 16:01:00 +00:00
gimpmenufactory.c added help IDs to all actions representing the toplevel popups and menus 2004-05-02 08:56:07 +00:00
gimpmenufactory.h added help IDs to all actions representing the toplevel popups and menus 2004-05-02 08:56:07 +00:00
gimpnavigationpreview.c app/widgets/gimphistogramview.c destroy GdkGCs in GtkWidget::unrealize(). 2003-11-10 02:00:19 +00:00
gimpnavigationpreview.h added VOID__DOUBLE_DOUBLE 2003-04-01 10:32:03 +00:00
gimpnavigationview.c app/widgets/gimphistogramview.c destroy GdkGCs in GtkWidget::unrealize(). 2003-11-10 02:00:19 +00:00
gimpnavigationview.h added VOID__DOUBLE_DOUBLE 2003-04-01 10:32:03 +00:00
gimppaletteeditor.c Fixed a 1.2 -> 2.0 regression that was forgotten: 2004-06-30 12:10:08 +00:00
gimppaletteeditor.h Fixed a 1.2 -> 2.0 regression that was forgotten: 2004-06-30 12:10:08 +00:00
gimppaletteselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppaletteselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppatternfactoryview.c added action_data_get_context() and macro return_if_no_context(). 2004-05-11 16:05:21 +00:00
gimppatternfactoryview.h Sort the plugin menu entries with the mnemonics stripped. Avoids weird 2004-03-17 14:14:18 +00:00
gimppatternselect.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppatternselect.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppdbdialog.c app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppdbdialog.h app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch] 2004-07-09 19:14:59 +00:00
gimppluginaction.c app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimppluginaction.h app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimppreview-popup.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimppreview-popup.h added virtual function get_popup_size() which returns a boolean indicating 2003-02-27 13:59:41 +00:00
gimppreview.c don't invoke the popup preview if there is no viewable. 2004-05-28 14:51:48 +00:00
gimppreview.h return early if the widget is not realized to enable destroying the widget 2003-08-13 23:28:26 +00:00
gimppreviewrenderer-utils.c app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00
gimppreviewrenderer-utils.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimppreviewrenderer.c queue an idle update when setting the viewable to NULL so the view gets 2004-07-06 13:18:42 +00:00
gimppreviewrenderer.h app/widgets/widgets-enums.h New function 2004-03-13 16:54:35 +00:00
gimppreviewrendererbrush.c removed trailing whitespace and #if 0'ed cruft. Cosmetics. 2003-12-21 11:07:40 +00:00
gimppreviewrendererbrush.h removed the constructors with a GimpViewable parameter and always create 2003-03-03 12:59:03 +00:00
gimppreviewrendererdrawable.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimppreviewrendererdrawable.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimppreviewrenderergradient.c added "gboolean reverse" to gimp_gradient_get_color_at() so all gradients 2003-07-22 14:24:11 +00:00
gimppreviewrenderergradient.h Argh, this should have gone with my last checkin... 2003-07-22 14:29:06 +00:00
gimppreviewrendererimage.c themes/Default/images/Makefile.am 2004-01-27 13:48:20 +00:00
gimppreviewrendererimage.h use GIMP_STOCK_IMAGE as default_stock_id. 2003-03-24 14:31:59 +00:00
gimppreviewrendererimagefile.c moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimppreviewrendererimagefile.h moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimppreviewrendererlayer.c app/gui/layers-commands.c (layers_text_tool) treat modified text layers 2004-03-18 18:00:38 +00:00
gimppreviewrendererlayer.h removed. 2003-09-06 22:02:12 +00:00
gimppreviewrenderervectors.c Accept NULL for ret_closed. 2003-09-30 15:16:51 +00:00
gimppreviewrenderervectors.h "The last of the Oldenburg commits" 2003-09-28 04:00:50 +00:00
gimppropwidgets.c removed GIMP_TYPE_COLOR. 2004-07-26 19:56:47 +00:00
gimppropwidgets.h added gimp_prop_label_new(). 2004-06-24 22:23:05 +00:00
gimpselectiondata.c Allow URI drops from apps linked against GLib < 2.4.4 to GIMP linked 2004-08-04 17:11:39 +00:00
gimpselectiondata.h added a "const gchar *format" parameter to 2004-07-08 11:27:48 +00:00
gimpselectioneditor.c Code review & cleanup: 2004-07-14 10:31:59 +00:00
gimpselectioneditor.h app/actions/documents-actions.c app/actions/documents-commands.c 2004-05-12 18:36:33 +00:00
gimpsessioninfo.c only write aux-info for properties that have been changed from their 2004-07-08 12:04:15 +00:00
gimpsessioninfo.h app/config/gimpconfig-deserialize.c removed redundant casts. 2004-07-08 00:09:41 +00:00
gimpstringaction.c app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimpstringaction.h app/widgets/gimpenumaction.[ch] app/widgets/gimppluginaction.[ch] added 2004-06-23 14:39:48 +00:00
gimpstrokeeditor.c Bill Skaggs <weskaggs@primate.ucdavis.edu> 2004-06-23 22:44:04 +00:00
gimpstrokeeditor.h renamed gimp_prop_size_entry_connect() to gimp_prop_coordinates_connect(). 2003-10-01 19:55:13 +00:00
gimptemplateeditor.c app/widgets/gimptemplateeditor.c plug-ins/common/gif.c set GTK_SHADOW_IN 2004-07-21 16:29:29 +00:00
gimptemplateeditor.h added an API to expand/collapse the "Advanced Options" frame. 2004-06-09 22:37:49 +00:00
gimptemplateview.c removed unused local variables. 2004-07-05 14:57:22 +00:00
gimptemplateview.h added action_data_get_context() and macro return_if_no_context(). 2004-05-11 16:05:21 +00:00
gimptexteditor.c removed "role" property because GtkWindow has an equivalent property now. 2004-07-08 21:57:05 +00:00
gimptexteditor.h made gimp_config_sync() and gimp_config_connect() also work on objects of 2004-03-11 18:47:37 +00:00
gimpthumbbox.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimpthumbbox.h unset the filename if the image is unnamed. 2004-06-22 15:11:35 +00:00
gimptoolbox-color-area.c added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND }, 2004-05-27 12:41:22 +00:00
gimptoolbox-color-area.h cleanup & cruft removal. 2003-10-13 12:42:52 +00:00
gimptoolbox-dnd.c app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed 2004-06-30 14:47:23 +00:00
gimptoolbox-dnd.h app/widgets/Makefile.am new files containing the toolbox' drop callbacks. 2003-06-06 15:14:47 +00:00
gimptoolbox-image-area.c app/widgets/Makefile.am new toolbox area which shows the active image. 2004-05-31 20:30:52 +00:00
gimptoolbox-image-area.h app/widgets/Makefile.am new toolbox area which shows the active image. 2004-05-31 20:30:52 +00:00
gimptoolbox-indicator-area.c app/widgets/Makefile.am new toolbox area which shows the active image. 2004-05-31 20:30:52 +00:00
gimptoolbox-indicator-area.h g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 17:07:02 +00:00
gimptoolbox.c connect to "accel-changed" of the accel_group using connect_object(), not 2004-07-22 11:18:52 +00:00
gimptoolbox.h app/widgets/Makefile.am new toolbox area which shows the active image. 2004-05-31 20:30:52 +00:00
gimptooldialog.c removed "role" property because GtkWindow has an equivalent property now. 2004-07-08 21:57:05 +00:00
gimptooldialog.h app/config/gimpconfigwriter.c app/core/gimpstrokeoptions.c 2004-05-24 14:51:15 +00:00
gimptooloptionseditor.c added new function gimp_get_mod_string() which takes a GdkModifierType and 2004-06-28 23:30:57 +00:00
gimptooloptionseditor.h added the scrolled window to the GimpToolOptionsEditor struct. 2004-01-30 22:10:31 +00:00
gimptoolview.c app/widgets/Makefile.am moved to libgimpwidgets. 2004-07-26 21:09:16 +00:00
gimptoolview.h if in list mode, add an "eye" column which toggles tool visibility. 2004-05-13 15:14:50 +00:00
gimpuimanager.c app/config/gimpconfigwriter.c app/core/gimpstrokeoptions.c 2004-05-24 14:51:15 +00:00
gimpuimanager.h put the image popup menu into a dummy menubar to work around the silly 2004-05-17 13:38:03 +00:00
gimpundoeditor.c app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new() 2004-07-12 16:59:36 +00:00
gimpundoeditor.h app/actions/documents-actions.c app/actions/documents-commands.c 2004-05-12 18:36:33 +00:00
gimpunitcombobox.c added a stock icon for "view-zoom-1-1". 2004-05-10 10:33:21 +00:00
gimpunitcombobox.h added a stock icon for "view-zoom-1-1". 2004-05-10 10:33:21 +00:00
gimpunitstore.c libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def 2004-07-27 16:39:00 +00:00
gimpunitstore.h app/widgets/Makefile.am app/widgets/widgets-types.h 2004-05-07 22:16:15 +00:00
gimpvectorstreeview.c return the proper type. 2004-07-06 10:54:46 +00:00
gimpvectorstreeview.h app/actions/documents-actions.c app/actions/documents-commands.c 2004-05-12 18:36:33 +00:00
gimpview-popup.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimpview-popup.h added virtual function get_popup_size() which returns a boolean indicating 2003-02-27 13:59:41 +00:00
gimpview.c don't invoke the popup preview if there is no viewable. 2004-05-28 14:51:48 +00:00
gimpview.h return early if the widget is not realized to enable destroying the widget 2003-08-13 23:28:26 +00:00
gimpviewablebutton.c app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpviewablebutton.h app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpviewabledialog.c removed "role" property because GtkWindow has an equivalent property now. 2004-07-08 21:57:05 +00:00
gimpviewabledialog.h To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimpviewrenderer-utils.c app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00
gimpviewrenderer-utils.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimpviewrenderer.c queue an idle update when setting the viewable to NULL so the view gets 2004-07-06 13:18:42 +00:00
gimpviewrenderer.h app/widgets/widgets-enums.h New function 2004-03-13 16:54:35 +00:00
gimpviewrendererbrush.c removed trailing whitespace and #if 0'ed cruft. Cosmetics. 2003-12-21 11:07:40 +00:00
gimpviewrendererbrush.h removed the constructors with a GimpViewable parameter and always create 2003-03-03 12:59:03 +00:00
gimpviewrendererdrawable.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimpviewrendererdrawable.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimpviewrenderergradient.c added "gboolean reverse" to gimp_gradient_get_color_at() so all gradients 2003-07-22 14:24:11 +00:00
gimpviewrenderergradient.h Argh, this should have gone with my last checkin... 2003-07-22 14:29:06 +00:00
gimpviewrendererimage.c themes/Default/images/Makefile.am 2004-01-27 13:48:20 +00:00
gimpviewrendererimage.h use GIMP_STOCK_IMAGE as default_stock_id. 2003-03-24 14:31:59 +00:00
gimpviewrendererimagefile.c moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimpviewrendererimagefile.h moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimpviewrendererlayer.c app/gui/layers-commands.c (layers_text_tool) treat modified text layers 2004-03-18 18:00:38 +00:00
gimpviewrendererlayer.h removed. 2003-09-06 22:02:12 +00:00
gimpviewrenderervectors.c Accept NULL for ret_closed. 2003-09-30 15:16:51 +00:00
gimpviewrenderervectors.h "The last of the Oldenburg commits" 2003-09-28 04:00:50 +00:00
gimpwidgets-constructors.c Bill Skaggs <weskaggs@primate.ucdavis.edu> 2004-06-23 22:44:04 +00:00
gimpwidgets-constructors.h added new function gimp_paint_mode_menu_set_history(). 2004-04-20 13:10:50 +00:00
gimpwidgets-utils.c app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gimpwidgets-utils.h app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties 2004-07-20 18:50:20 +00:00
gtkhwrapbox.c require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkhwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkvwrapbox.c require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkvwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkwrapbox.c Fix wrapped property. 2004-01-12 01:32:20 +00:00
gtkwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
makefile.msc build but *dont link* display-enums.obj, widget-enums.obj and 2004-08-01 20:51:12 +00:00
widgets-enums.c added still unused flags type GimpDirtyMask. 2004-07-28 11:50:20 +00:00
widgets-enums.h Applied a bunch of AIX portability fixes (bug #148813): 2004-07-30 00:57:22 +00:00
widgets-types.h themes/Default/images/Makefile.am removed ... 2004-08-04 18:15:41 +00:00