Commit Graph

161 Commits

Author SHA1 Message Date
Michael Natterer d9b5207aa2 Change licence to GPLv3 (and to LGPLv3 for libgimp).
2009-01-17  Michael Natterer  <mitch@gimp.org>

	* all files with a GPL header and all COPYING files:

	Change licence to GPLv3 (and to LGPLv3 for libgimp).

	Cleaned up some copyright headers and regenerated the parsers in
	the ImageMap plugin.


svn path=/trunk/; revision=27913
2009-01-17 22:28:01 +00:00
Martin Nordholts 4255e43681 Bug 555954 – Merge Tagging of Gimp Resources GSoC Project
Merge the rest of the tagging code developed on the tagging branch
by Aurimas Juška. Development will now continue in trunk.

* app/core/gimptag.[ch]: New files (not strictly true but almost)
implementing the represention of a tag.

* app/core/gimptagcache.[ch]: New files implementing functionality
for loading and saving tags to tags.xml, and assigning loaded tags
to tagged objects.

* app/core/gimpfilteredcontainer.[ch]: New files implementing a
tag filtered GimpContainer.

* app/widgets/gimptagentry.[ch]: New files implementing a
GtkEntry-like widget for entering tags.

* app/widgets/gimpcombotagentry.[ch]: New files implementing a
combobox-like widget for selecting tags.

* app/widgets/gimptagpopup.[ch]: New files implementing a popup of
all available tags that can be selected and combined in a
checkbox-like way.

* app/core/gimp.[ch]: Add a GimpTagCache member and manage tag
assignment and saving and loading to/from tags.xml.

* app/widgets/gimpdatafactoryview.c: Add the tag query and tag
assignment widgets to the UI and show the tag filtered items
instead of all items.

* app/core/Makefile.am
* app/widgets/Makefile.am: Add new files.

* app/core/core-types.h
* app/widgets/widgets-types.h: Add new types.

svn path=/trunk/; revision=27816
2008-12-20 14:46:54 +00:00
Michael Natterer 069bbbd142 move GimpCursorView typedef from here...
2008-11-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h: move GimpCursorView typedef from
	here...

	* app/display/display-types.h: ...to here.


svn path=/trunk/; revision=27585
2008-11-09 19:34:12 +00:00
Michael Natterer 9c299a8f03 app/widgets/Makefile.am app/widgets/widgets-types.h new widget factored
2008-10-24  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfilleditor.[ch]: new widget factored out of
	GimpStrokeEditor.

	* app/widgets/gimpstrokeeditor.[ch]: derive from GimpFillEditor
	and remove UI for the properties of GimpFillOptions.


svn path=/trunk/; revision=27390
2008-10-24 17:55:30 +00:00
Michael Natterer 0194327f6d app/widgets/Makefile.am app/widgets/widgets-types.h new simple widget
2008-09-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactioneditor.[ch]: new simple widget which
	contains a GimpActionView plus the search entry.

	* app/dialogs/keyboard-shortcuts-dialog.c: use the new widget
	instead of implementing the search entry here.

	* app/widgets/gimpcontrollereditor.c: use a GimpActionEditor
	instead of GimpActionView so the actions become searchable here
	too.


svn path=/trunk/; revision=26870
2008-09-05 10:37:06 +00:00
Michael Natterer ba7d6020da app/widgets/Makefile.am app/widgets/widgets-types.h skeleton of a widget
2008-06-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsettingseditor.[ch]: skeleton of a widget to
	manage the list of saved settings for the image map tools. Does
	absolutely nothing yet apart from displaying the list of settings.

	* app/widgets/gimpsettingsbox.[ch]: add "Manage Settings" menu item
	and show a dialog containing the new widget.


svn path=/trunk/; revision=25977
2008-06-22 17:31:25 +00:00
Michael Natterer 8912b68290 app/widgets/Makefile.am app/widgets/widgets-types.h new widget containing
2008-06-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsettingsbox.[ch]: new widget containing the
	combo and menu button for the image map tool settings plus most of
	their logic. Has "import" and "export" signals that might go away
	if I figure a way to nicely abstract that. Contains some minor
	bugfixes and cosmetic improvements compared to the old code.

	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpimagemaptool-settings.[ch]: changed accordingly,
	mostly removal of lots of code that is now in the widget.


svn path=/trunk/; revision=25943
2008-06-13 11:56:46 +00:00
Sven Neumann 5abe098abe app/widgets/Makefile.am app/widgets/widgets-types.h added simple scale
2008-05-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpscalebutton.[ch]: added simple scale button widget
	derived from GtkScaleButton.

svn path=/trunk/; revision=25803
2008-05-26 15:01:36 +00:00
Michael Natterer 0b0d0aad78 turn into a GimpObject subclass. No logical changes yet.
2008-05-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpsessioninfo.[ch]: turn into a GimpObject
	subclass. No logical changes yet.

	* app/widgets/widgets-types.h
	* app/widgets/gimpdialogfactory.c: changed accordingly.


svn path=/trunk/; revision=25655
2008-05-13 21:17:11 +00:00
Sven Neumann 7bacfae912 app/widgets/widgets-types.h formatting.
2008-05-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/widgets-types.h 
	* app/widgets/gimpfiledialog.c: formatting.


svn path=/trunk/; revision=25585
2008-05-08 10:44:05 +00:00
Sven Neumann f23d046965 app/widgets/Makefile.am app/widgets/widgets-types.h added GimpWindow class
2008-04-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpwindow.[ch]: added GimpWindow class and moved
	key-press-event handler from GimpDock to this class.

	* app/widgets/gimpdock.[ch]:
	* app/display/gimpdisplayshell.[ch]: derive from GimpWindow.


svn path=/trunk/; revision=25541
2008-04-28 16:30:55 +00:00
Sven Neumann 384835d7e2 app/widgets/Makefile.am app/widgets/widgets-types.h
2008-02-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguageentry.[ch]
	* app/widgets/gimptexteditor.c: turned language entry into a 
widget.


svn path=/trunk/; revision=24866
2008-02-11 20:19:03 +00:00
Sven Neumann 7f2a8fc35a added configure checks for the iso-codes package.
2008-02-07  Sven Neumann  <sven@gimp.org>

	* configure.in: added configure checks for the iso-codes package.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimplanguagestore.[ch]:
	* app/widgets/gimplanguagestore-parser.[ch]: added rough outline
	of GtkListStore for language selection.

svn path=/trunk/; revision=24828
2008-02-07 16:50:11 +00:00
Michael Natterer c22ca3f4f6 app/widgets/widgets-types.h app/widgets/Makefile.am new widget
2007-11-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h
	* app/widgets/Makefile.am
	* app/widgets/gimphandlebar.[ch]: new widget implementing the slider
	bar known from histogram and levels.

	* app/widgets/gimphistogrambox.[ch]: use the new widget. General
	cleanup and UI streamlining.


svn path=/trunk/; revision=24198
2007-11-20 09:10:39 +00:00
Michael Natterer ae1f2eb2bc app/widgets/Makefile.am app/widgets/widgets-types.h new GimpHistogramView
2007-11-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcurveview.[ch]: new GimpHistogramView subclass
	which does all the curve stuff.

	* app/widgets/gimphistorgramview.[ch]: removed all curve code again.

	* app/tools/gimpcurvestool.c: changed accordingly.


svn path=/trunk/; revision=24051
2007-11-04 13:09:10 +00:00
Sven Neumann 718ca7c790 app/widgets/Makefile.am app/widgets/widgets-types.h new widget derived
2007-06-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagecommenteditor.[ch]: new widget derived from
	GimpImageParasiteView. Basically the code that used to live in
	image-properties-dialog.c.

	* app/dialogs/image-properties-dialog.c: use the comment editor.

svn path=/trunk/; revision=22846
2007-06-27 09:46:00 +00:00
Michael Natterer dfd1309b19 app/widgets/Makefile.am app/widgets/widgets-types.h remove
2007-04-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: remove GimpCellRenererAccel.

	* app/widgets/gimpactionview.c: use GtkCellRendererAccel instead.
	If an action has no label, use its name as label. Always show the
	"Name" column because there are too many actions with confusingly
	similar names.


svn path=/trunk/; revision=22256
2007-04-16 13:43:31 +00:00
Sven Neumann fd2b9ce3e9 app/plug-in/plug-in-icc-profile.[ch] removed run-mode argument from
2006-12-18  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-icc-profile.[ch]
	* plug-ins/common/lcms.c: removed run-mode argument from
	plug-in-icc-profile-info. Added new procedure to obtain
information
	about a color profile on disk.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprofilechooserdialog.[ch]: added a first draft
	of a file-chooser dialog for selecting a color profile.

	* app/dialogs/preferences-dialog.c: use it.
2006-12-18 08:15:56 +00:00
Sven Neumann 41237259c9 In all files, changed the standard copyright notice to say "GIMP - The GNU
2006-12-09  Sven Neumann  <sven@gimp.org>

        * In all files, changed the standard copyright notice to say
        "GIMP - The GNU Image Manipulation Program".
2006-12-09 21:33:38 +00:00
Sven Neumann 4f4dea5645 app/widgets/Makefile.am app/widgets/widgets-types.h new abstract base
2006-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageparasiteview.[ch]: new abstract base class.

	* app/widgets/gimpimageprofileview.[ch]: derive from
	GimpImageParasiteView.
2006-11-03 13:52:17 +00:00
Sven Neumann 13ba2a52db added signals "parasite-attached" and "parasite-detached".
2006-10-25  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: added signals "parasite-attached" and
	"parasite-detached".

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimageprofileview.[ch]: draft of a new widget
that
	displays color profile information.

	* app/widgets/gimpimagepropview.c: minor cleanup and bug fix.

	* app/dialogs/image-properties-dialog.c: added Color Profile
	information.

	* plug-ins/common/lcms.c: bug fixes.
2006-10-25 07:31:04 +00:00
Michael Natterer 7d08450cbc Really fix bug :
2005-09-12  Michael Natterer  <mitch@gimp.org>

	Really fix bug :

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpdockseparator.[ch]: new widget implementing the
	droppable separator bar in docks.

	* app/widgets/gimpdock.c: use it and removed local separator
	utility functions.

	* app/widgets/gimptoolbox.c: use GimpDockSeparator API to show/hide
	the label. Expand the separator initially.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: the separator height style property moved
	from GimpDock to GimpDockSeparator.
2005-09-12 17:48:40 +00:00
Michael Natterer 6dbac4fae1 app/paint/gimppencil.h app/paint/gimppenciloptions.h
2005-08-21  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppencil.h
	* app/paint/gimppenciloptions.h
	* app/widgets/widgets-types.h
	* app/widgets/gimptooldialog.h: don't simply typedef object
	instance structs which add no members as their parent instance
	structs. Give them their own instance structs.  Fixes gtk-doc
	confusion.
2005-08-21 17:28:18 +00:00
Michael Natterer c0a10c8303 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppaletteview.[ch]: new widget which manages the
	selected palette entry itself and emits "selected", "activated"
	and "context" signals. Not used yet.

	* app/widgets/gimpviewrendererpalette.[ch]: reimplemented palette
	drawing: added optional grid drawing and APIs to configure the
	renderer. Should be ready for the palette editor now.
2005-07-14 14:41:29 +00:00
Michael Natterer 98dc0a67b7 app/widgets/Makefile.am app/widgets/widgets-types.h new view renderer,
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererpalette.[ch]: new view renderer,
	does nothing yet except chaining up in ::render().

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_by_viewable_type): use it for palettes.
2005-07-13 20:11:24 +00:00
Sven Neumann a8318e18c5 added utility functions to copy and to free a dash pattern.
2005-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]: added utility functions to copy
	and to free a dash pattern.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendererdashes.[ch]: added a simple cell
	renderer to visualize a dash pattern.

	* app/widgets/gimpstrokeeditor.c: show previews of the dash
	presets in the combo-box.
2005-05-21 20:24:42 +00:00
Michael Natterer 1f1305c372 Some dock refactoring which separates the docking logic from active image
2005-05-11  Michael Natterer  <mitch@gimp.org>

	Some dock refactoring which separates the docking logic from
	active image and UI manager stuff:

	* app/widgets/gimpmenudock.[ch]: new widget renamed from
	GimpImageDock, zero changes except the name change.

	* app/widgets/gimpimagedock.[ch]: new widget derived from
	GimpDock. Keeps the UI manager.

	* app/widgets/gimpdock.[ch]: removed the UI manager. GimpDock only
	contains the basic docking logic again.

	* app/widgets/gimpmenudock.[ch]
	* app/widgets/gimptoolbox.[ch]: derive them from GimpImageDock.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/actions/dialogs-commands.c
	* app/actions/dock-actions.c
	* app/actions/dock-commands.c
	* app/actions/dockable-commands.c
	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-05-11 20:26:12 +00:00
Michael Natterer 92ad7c1d53 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-05-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerlist.[ch]: new widget which allows
	adding/removing controllers using two lists of available/active
	controllers. Work in progress...

	* app/widgets/gimpcontrollerinfo.[ch]: derive it from GimpVieable
	so it can have an icon (unfinished). Added convenience constructor
	gimp_controller_info_new().

	* app/dialogs/preferences-dialog.c: use a GimpControllerList
	instead of a notebook of GimpControllerEditors.
2005-05-09 09:35:41 +00:00
Michael Natterer dba31b149c More unfinished replacement for the info window:
2005-04-05  Michael Natterer  <mitch@gimp.org>

	More unfinished replacement for the info window:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagepropview.[ch]: new widget showing an image's
	size, resolution, mode, memsize etc.

	* app/dialogs/Makefile.am
	* app/dialogs/image-properties-dialog.[ch]: a dialog keeping the
	widget.

	* app/widgets/gimphelp-ids.h: a help ID for the dialog.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* menus/image-menu.xml.in: action and menu entry for the dialog.
2005-04-04 22:34:29 +00:00
Michael Natterer 0231374c86 added new signals "sample-point-added" and "sample-point-removed" and
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added new signals "sample-point-added"
	and "sample-point-removed" and public functions to emit them.

	* app/core/gimpimage-sample-points.c (gimp_image_add_sample_point)
	(gimp_image_remove_sample_point): emit them accordingly.

	* app/core/gimpimage-undo-push.c (undo_pop_image_sample_point):
	ditto.

	(undo_pop_image_guide)
	(undo_pop_image_sample_point): added comments why we add/remove
	stuff manually instead of using the GimpImage APIs.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcursorview.[ch]
	* app/widgets/gimpsamplepointeditor.[ch]: new widgets.
	GimpCursorView is a replacement for the info window's "Cursor"
	page, GimpSamplePointEditor is a view on an image's sample points.
	The sample point editor does nothing yet except keeping a 2x2 grid
	of GimpColorFrames. Addresses bug .

	* app/dialogs/dialogs.c
	* app/dialogs/dialogs-constructors.[ch]: register the new widgets
	as dockable dialogs.

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* menus/dialogs-menuitems.xml: added actions and menu items for
	the new dialogs.

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor)
	(gimp_display_shell_clear_cursor): update the new cursor view.

	* app/widgets/gimphelp-ids.h: help IDs for the new dialogs.

	* app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode):
	changed description "Pixel values" to "Pixel" because the former
	was too long.
2005-04-03 15:48:03 +00:00
Sven Neumann 3ba107f1f9 app/widgets/Makefile.am app/widgets/gimpfgbgview.[ch] added new widget
2005-03-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpfgbgview.[ch]
	* app/widgets/widgets-types.h: added new widget GimpFgBgView;
	somewhat similar to GimpFgBgEditor but a lot simpler.

	* app/widgets/gimpcoloreditor.c: use GimpFgBgView as preview widget.
	Closes bug .

	* app/widgets/gimpfgbgeditor.c: gracefully handle a very small
	size allocation.
2005-03-31 13:39:18 +00:00
Sven Neumann 3069695265 app/widgets/Makefile.am app/widgets/widgets-types.h
2005-01-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenumcombobox.[ch]
	* app/widgets/gimpenumstore.[ch]: moved GimpEnumStore and
	GimpEnumComboBox from here ...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpenumcombobox.[ch]
	* libgimpwidgets/gimpenumstore.[ch]: ... to libgimpwidgets.

	* app/dialogs/convert-dialog.c
	* app/dialogs/scale-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c
	* data/images/gimp-splash.png: changed includes accordingly.
2005-01-21 22:59:51 +00:00
Michael Natterer ea1b88f580 app/widgets/Makefile.am app/widgets/widgets-types.h new widget built from
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
	preliminary code from the prefs dialog. Prerequisite for finally
	fixing bug .

	* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 12:26:47 +00:00
Sven Neumann 8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann 22a1384b5a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
	properties does matter.

	* app/dialogs/Makefile.am
	* app/dialogs/scale-dialog.[ch]: added first version of a new
	Scale dialog in an attempt to address bug .

	* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 14:59:14 +00:00
Michael Natterer 96a27b59cf app/actions/brushes-actions.c app/actions/gradients-actions.c
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c: made the "foo-edit" actions
	GimpStringActions and pass the identifier of the editor dialog
	to the callback.

	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
	show the editor dialog here instead of calling view->edit_func().

	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
	gradient and palette edit_funcs.

	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
	member and parameters and create the edit button unconditionally.

	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
	needed any longer.

	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
	and follow the edit_func removal.

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
	stuff.

	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 10:45:49 +00:00
Michael Natterer ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug 
2004-09-14 12:06:28 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug .

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Michael Natterer 06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs ,  and .

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Sven Neumann 744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
Michael Natterer 62bf62a151 app/core/gimpmarshal.list app/widgets/Makefile.am
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
	which displays an accelerator and allows to edit it (ripped
	out of libegg and modified).

	* app/widgets/gimpactionview.c: use the new renderer and connect
	to its "accel-edited" signal (its callback is one huge mess that
	needs to be cleaned up). Added ugly hack to work around GTK+ API
	limitation that seems to prevent implementing a shortcut editor in
	a sane way.

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/tools-actions.c: added ugly hacks here, too.

	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
	editor by Close.
2004-07-21 00:39:46 +00:00
Michael Natterer 94fc8f15a1 app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties
2004-07-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionfactory.[ch]
	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
	properties to GtkActionGroup and allow to register them in the
	GimpActionFactory.

	* app/actions/actions.c: register user visible labels and icons
	with all action groups.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactionview.[ch]: new widget which shows a
	treeview of action groups and their actions & shortcuts.

	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
	utility function.

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_get_accel_string() utility function.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_ui_manager() which will be used for setting
	up the controller mapping dialog.

	* app/gui/preferences-dialog.c: added a "Configure Keyboard
	Shortcuts" button which pops up a GimpControllerView. Work in
	progress...
2004-07-20 18:50:20 +00:00