Commit Graph

9074 Commits

Author SHA1 Message Date
Sven Neumann db6dff283f try to convert the result of gimp_directory() to UTF-8 and bail out with a
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/sanity.c (sanity_check_filename_encoding): try to convert
	the result of gimp_directory() to UTF-8 and bail out with a
	moderately helpful error message if this conversion fails. Works
	around bug #150917. Also marked these strings for translation.
2004-08-26 09:48:32 +00:00
Sven Neumann 7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
David Odin d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
Manish Singh b6d3a912fd Guard against bogus logical screen dimensions. Fixes bug #151053.
2004-08-25  Manish Singh  <yosh@gimp.org>

        * plug-ins/common/gifload.c: Guard against bogus logical screen
        dimensions. Fixes bug #151053.
2004-08-25 22:32:54 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann 8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
William Skaggs c92a38626b Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
2004-08-25 18:26:06 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin 54fa5a0af9 eradicate some more previews in favor of views.
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
  in favor of views.
2004-08-25 17:54:12 +00:00
William Skaggs 856b87b105 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/Makefile.am: added ggr.txt to list.
2004-08-25 17:50:35 +00:00
William Skaggs 21ba16c67d Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: added new file decribing the ggr
	(Gimp gradient) file format.
2004-08-25 17:41:34 +00:00
David Odin f168881c18 app/display/gimpnavigationview.c renamed these files to...
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...

* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
  changed GimpNavigationView to GimpNavigationEditor since it is really
  inherited from GimpEditor anyway.

This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.

* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 16:02:10 +00:00
Michael Natterer da34232a04 print bad '%' sequences literally instead of warning (g_warning() is for
2004-08-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): print bad '%' sequences
	literally instead of warning (g_warning() is for programming
	errors only and must never be triggered by bad or intermediate
	user input). Fixes bug #150676
2004-08-25 14:38:49 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Sven Neumann 6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann 509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
David Odin f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann 0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Simon Budig e86dff66da Implemented the ellipse basic shape differently to avoid possible rounding
2004-08-22  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
	shape differently to avoid possible rounding issues with
	the _arcto () command.

	* app/vectors/gimpvectors-import.c: properly close the rounded
	rectangles.
2004-08-22 12:31:47 +00:00
Sven Neumann d6a016b4b4 support optional center coordinates for the "rotate" transformations.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c (parse_svg_transform): support
	optional center coordinates for the "rotate" transformations.
	(parse_svg_transform): apply transformations in reverse order. The
	SVG spec is rather confusing here.
2004-08-22 10:50:22 +00:00
Sven Neumann 59e521c64f fixed a bug I introduced with my last commit.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
	a bug I introduced with my last commit.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
2004-08-21 15:47:31 +00:00
Sven Neumann 6f3c1ae503 added new function gimp_bezier_stroke_new_ellipse() that provides a simple
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.[ch]: added new function
	gimp_bezier_stroke_new_ellipse() that provides a simple API to
	create a bezier stroke that represents an ellipse.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "circle" and "ellipse".
2004-08-21 13:50:19 +00:00
Simon Budig 5dd10c748d Fix some GUI issues. Make the relation between the dimension parameter and
2004-08-21  Simon Budig  <simon@gimp.org>

	* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
	between the dimension parameter and the rank thingies more clear
	also changed to a nicer layout.
2004-08-21 10:38:38 +00:00
Sven Neumann e63c6511fd added support for the basic SVG shapes "polyline" and "polygon".
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "polyline" and "polygon".
2004-08-21 09:41:12 +00:00
Sven Neumann 905fcfd6b5 added support for importing the basic SVG shape "line". Other shapes will
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for importing
	the basic SVG shape "line". Other shapes will follow...
2004-08-21 08:03:39 +00:00
Sven Neumann c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
Sven Neumann f5045bdcdb declare local function as static.
2004-08-20  Sven Neumann  <sven@gimp.org>

	* modules/controller_linux_input.c: declare local function as static.
2004-08-20 20:58:12 +00:00
Michael Schumacher 38153309eb modified the coordinate insertion into the file name to leave the file
2004-08-19  Michael Schumacher <schumaml@cvs.gnome.org>

	* plug-ins/common/guillotine.c: modified the coordinate insertion
	into the file name to leave the file extension intact, changed the
	format of the coordinates. Fixes bug #101901.
2004-08-19 14:26:24 +00:00
Manish Singh 83a94230ed app/widgets/gimpcellrendereraccel.c app/widgets/gimphistogrambox.c Get rid
2004-08-18  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimphistogrambox.c
        * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-19 00:21:55 +00:00
Sven Neumann 0620ee069e no need to set a size_request here.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/gui/color-notebook.c: no need to set a size_request here.

	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

	* libgimpwidgets/gimpcolorscales.c
	* modules/colorsel_cmyk.c: don't set a minimum width on the color
	scales. Improves behaviour for narrow color dockables.
2004-08-18 21:50:26 +00:00
Sven Neumann d5cd7ae3f1 fixed crashes that occured with small sizes, some code cleanups and a
2004-08-18  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_triangle.c: fixed crashes that occured with
	small sizes, some code cleanups and a simple optimization.
2004-08-18 18:09:06 +00:00
Sven Neumann 2d5ee4485d define GIMP_HELP_DOCK_SEPARATOR.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: help-ids are never used directly,
	use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-18 09:53:38 +00:00
Simon Budig f960771bd3 Made the triangle colorselector resizeable. Removed minimum size request
2004-08-17  Simon Budig  <simon@gimp.org>

	* modules/colorsel_triangle.c: Made the triangle colorselector
	resizeable. Removed minimum size request (would probably need some
	testing for *very* small sizes though).
2004-08-17 20:21:11 +00:00
William Skaggs 8e36dd8ffb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 17:46:48 +00:00
Sven Neumann 7755461070 reset the "cancel" signal handler id when a new progress is set.
2004-08-17  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
	the "cancel" signal handler id when a new progress is set.
2004-08-17 15:16:44 +00:00
Sven Neumann 7b1cc4ae0c minor cleanups.
2004-08-17  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_cmyk.c: minor cleanups.

	* modules/colorsel_water.c: let the widget take the available
	space, don't set a minimum size.
2004-08-17 15:07:27 +00:00
Sven Neumann ed2116ac89 app/plug-in/plug-in-progress.c app/plug-in/plug-in-run.c don't keep a
2004-08-17  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c: don't keep a strong reference to the
	GimpProgress object, instead use a weak reference and deal with
	the progress being destroyed while the plug-in is running.
	Fixes bug #150194.
2004-08-17 08:21:30 +00:00
Sven Neumann 6543cfde20 fixed labels in CMYK mode. Fixes bug #150213.
2004-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
	labels in CMYK mode. Fixes bug #150213.
2004-08-16 07:24:42 +00:00
David Odin 1c39d63714 fixed a typo preventing the preview to be redrawn correctly in some case.
* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
  redrawn correctly in some case. Reported by AndyFitz.
2004-08-16 01:30:33 +00:00
Sven Neumann 1be91fc24b minor cleanups.
2004-08-15  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_triangle.c: minor cleanups.

	* modules/colorsel_water.c: GimpPreviewArea seems like overkill
	here, use a GtkDrawingArea instead.
2004-08-15 18:01:11 +00:00
David Odin 7ef3447a69 modules/colorsel_triangle.c Replaced the GtkPreviews by GimpPreviewAreas.
* modules/colorsel_triangle.c
* modules/colorsel_water.c: Replaced the GtkPreviews by
  GimpPreviewAreas.
2004-08-15 15:31:20 +00:00
Manish Singh c1d5c94b03 make sure array length values are not negative, to prevent bad calls to
2004-08-14  Manish Singh  <yosh@gimp.org>

        * libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
        length values are not negative, to prevent bad calls to g_new.
        Addresses bug #150154.
2004-08-15 06:52:45 +00:00
Sven Neumann 63355f333b no need to link gimp-help-lookup with any GIMP libraries.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
	any GIMP libraries.
2004-08-14 18:13:41 +00:00
Sven Neumann 1d669a5b4e allow to specify the location of the index files independently from the
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/domain.[ch]: allow to specify the location of the
	index files independently from the base URL.

	* plug-ins/help/help.c: changed accordingly.

	* plug-ins/help/gimp-help-lookup.c: added command-line options to
	specify base URI and root directory for index files.
2004-08-14 17:53:40 +00:00
Sven Neumann dba01430e9 don't mess up the order of languages.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/locales.c (locales_parse): don't mess up the order
	of languages.

	* plug-ins/help/gimp-help-lookup.c: parse command-line options,
	added --help output.
2004-08-14 16:59:16 +00:00
Sven Neumann df6dc99d05 moved some defines to the header file.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/help.[ch]: moved some defines to the header file.

	* plug-ins/help/domain.c: trivial change to remove the libgimpbase
	dependency.

	* plug-ins/help/Makefile.am
	* plug-ins/help/gimp-help-lookup.c: added a very simple
	command-line tool that allows to lookup a help-id.
2004-08-14 15:47:22 +00:00
David Odin 21de121062 update the preview when the user choose a different algorithm from the
* plug-ins/common/edge.c: update the preview when the user choose a
  different algorithm from the combo box. This was one of the main
  reasons to have a preview here, after all.
2004-08-12 23:31:15 +00:00
Sven Neumann b8d208a92f forgot to commit ChangeLog changes 2004-08-12 22:30:25 +00:00