Commit Graph

1896 Commits

Author SHA1 Message Date
William Skaggs 7a3eee51f0 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/paint/gimpbrushcore.c
	* app/paint/gimppaintoptions.c
	* app/paint/gimppaintoptions.h
	* app/tools/gimppaintoptions-gui.c: reverted last change, and
	applied full patch from Dave Ahlswede in bug #149576.
2005-01-01 00:04:37 +00:00
Sven Neumann cbb9ba9860 fixed label.
2004-12-18  Sven Neumann  <sven@gimp.org>

	* app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label.
2004-12-18 17:05:32 +00:00
Sven Neumann a493f0dea2 don't use the rect-select cursor if the tool is in move-layer mode.
2004-12-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't
	use the rect-select cursor if the tool is in move-layer mode.
	Spotted by Joao S. O. Bueno, bug #161465.
2004-12-17 15:16:36 +00:00
Simon Budig 7228441256 Minor fix: Update the Graph after adding a control point
(merged into the last Changelog entry)
2004-12-17 13:47:29 +00:00
Simon Budig 306fa33a01 Kill some nonsensical code that tried to set control points in a free form
2004-12-17  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcurvestool.c: Kill some nonsensical code that
	tried to set control points in a free form curve based on the
	image coordinates (huh?). Untabbified.
2004-12-17 13:11:29 +00:00
Sven Neumann da12388bd2 take drawable offsets into account. Fixes bug #161508.
2004-12-17  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color):
	take drawable offsets into account. Fixes bug #161508.
2004-12-17 12:31:11 +00:00
Sven Neumann f21cde69a0 don't show the Crop tool window if Shift is being pressed on the initial
2004-12-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: don't show the Crop tool window if
	Shift is being pressed on the initial button_press event.
2004-12-13 21:09:43 +00:00
Michael Natterer 13a32c91cc applied patch from Sven Neumann which removes code that prevents layers
2004-12-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c: applied patch from Sven Neumann
	which removes code that prevents layers with mask from being
	transformed.

	* app/tools/gimptransformtool.[ch]: added "gboolean mask_empty"
	parameter to GimpTransformTool::transform(). Needed because the
	selection gets cleared by cutting from the drawable and we need
	the selection's state before that cutting.

	(gimp_transform_tool_doit): pass "mask_empty" to
	GimpTransformTool::transform():

	* app/tools/gimptransformtool.c (gimp_transform_tool_real_transform)
	* app/tools/gimpfliptool.c (gimp_flip_tool_transform): when
	transforming a layer with mask and there is no selection,
	transform the mask just as if it was a linked item.
	Fixes bug #143837 and bug #159697.
2004-12-06 14:37:00 +00:00
Sven Neumann 027cec0d18 made the Size scale logarithmic as suggested in bug #159632.
2004-11-27  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
	as suggested in bug #159632.
2004-11-27 13:06:39 +00:00
Sven Neumann 2dcbec8418 only show the Incremental toggle for tools that use it (bug #159306).
2004-11-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
	show the Incremental toggle for tools that use it (bug #159306).
2004-11-26 15:14:21 +00:00
Michael Natterer d8a5ca6c1b added new function gimp_toggle_button_set_visible() which can be used as
2004-11-23  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_toggle_button_set_visible() which can be used as "toggled"
	callback on a GtkToggleButton and sets a widget (in)visible
	according to the toggle's "active" state.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c: use it to hide (rather than
	just insensitize) the seldomly used "Feather edges", "Autoshrink
	selection", "Adaptive supersampling", "Fade out" and "Use color
	from gradient" widgets when their enabling toggle is unchecked.
	Makes the affected tool options much less crowded and noisy in
	their default appearance. Fixes bug #159008.
2004-11-23 17:01:51 +00:00
Michael Natterer 512b1120c4 added a "menu_factory" parameter instead of trying to get it from the
2004-11-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
	added a "menu_factory" parameter instead of trying to get it from
	the toplevel GimpDock (which does not exists if the tool options
	dialog does not exist). Fixes bug #159071.

	* app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
	menu_factory.

	* app/dialogs/dialogs.c (dialogs_init): pass the global menu
	factory also when constructing the "toplevel" dialog factory so
	the above works.
2004-11-22 16:03:54 +00:00
Hans Breuer 696663a611 [new file] app/dialogs/Makefile.am : added to EXTRA_DIST
2004-09-21  Hans Breuer  <hans@breuer.org>

	* app/dialogs/makefile.msc : [new file]
	  app/dialogs/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/gimp.rc : let wilber be first

	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/scrip-fu.c : there
	is no script-fu-server on win32
2004-11-21 14:22:45 +00:00
Michael Natterer c0d9179492 removed redundant "gimage" parameter.
2004-11-16  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
	removed redundant "gimage" parameter.

	* app/tools/gimpeditselectiontool.c: changed accordingly.
2004-11-16 13:52:04 +00:00
Manish Singh 5d01581069 Fix a bunch of warnings from Sparse:
2004-11-13  Manish Singh  <yosh@gimp.org>

        Fix a bunch of warnings from Sparse:

        * app/actions/dockable-commands.c
        * app/actions/layers-actions.c
        * app/actions/view-commands.c
        * app/base/pixel-surround.c
        * app/config/gimpconfig-utils.c
        * app/config/gimpscanner.c
        * app/core/gimpbrushgenerated.c
        * app/core/gimpcontainer.c
        * app/core/gimpimage.c
        * app/dialogs/palette-import-dialog.c
        * app/file/gimprecentlist.c
        * app/plug-in/plug-in-params.c
        * app/text/gimptext-compat.c
        * app/text/gimptext-parasite.c
        * app/vectors/gimpbezierstroke.c
        * app/vectors/gimpstroke.c
        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimpselectiondata.c
        * app/xcf/xcf.c
        * libgimp/gimp.c
        * libgimpthumb/gimpthumb-utils.c
        * libgimpthumb/gimpthumbnail.c
        * modules/cdisplay_proof.c
        * plug-ins/Lighting/lighting_ui.c
        * plug-ins/common/csource.c
        * plug-ins/common/glasstile.c
        * plug-ins/common/nova.c
        * plug-ins/common/pcx.c
        * plug-ins/common/pnm.c
        * plug-ins/common/randomize.c
        * plug-ins/common/screenshot.c
        * plug-ins/common/sel_gauss.c
        * plug-ins/common/spheredesigner.c
        * plug-ins/common/wind.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gimpressionist/gimpressionist.c
        * plug-ins/ifscompose/ifscompose.c
        * plug-ins/print/gimp_main_window.c
        * plug-ins/print/print.c: Cleanup integer vs. pointer confusion.

        * app/base/temp-buf.c
        * app/dialogs/about-dialog.c
        * plug-ins/common/bumpmap.c
        * plug-ins/common/jigsaw.c
        * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.

        * app/config/gimpconfig-deserialize.c
        * app/config/gimpconfig-path.c
        * app/config/gimpconfigwriter.c
        * app/core/gimpgradient.c
        * app/tools/gimpdrawtool.c
        * plug-ins/common/nlfilt.c
        * plug-ins/common/unsharp.c
        * plug-ins/common/zealouscrop.c: Define inline functions before they
        are used.

        * app/core/gimpdrawable-blend.c: PixelRegion definition was changed
        some time ago, but the initialization here didn't change. Fix it.

        * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
        assign token twice in a row.

        * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
        need to initialize file_data, since the code fills out all the fields.

        * plug-ins/common/CML_explorer.c
        * plug-ins/common/vpropagate.c: Declare function pointers fully.

        * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
        we assume we can use the "inline" keyword always.

        * plug-ins/common/psd_save.c
        * plug-ins/common/vinvert.c
        * plug-ins/gfig/gfig-arc.c
        * plug-ins/gfig/gfig-bezier.c
        * plug-ins/gfig/gfig-circle.c
        * plug-ins/gfig/gfig-dialog.c
        * plug-ins/gfig/gfig-dobject.c
        * plug-ins/gfig/gfig-ellipse.c
        * plug-ins/gfig/gfig-line.c
        * plug-ins/gfig/gfig-poly.c
        * plug-ins/gfig/gfig-spiral.c
        * plug-ins/gfig/gfig-star.c
        * plug-ins/gfig/gfig.c
        * plug-ins/gimpressionist/orientmap.c
        * plug-ins/gimpressionist/placement.c
        * plug-ins/gimpressionist/sizemap.c
        * plug-ins/imagemap/imap_grid.c
        * plug-ins/imagemap/imap_main.c
        * plug-ins/imagemap/imap_preferences.c
        * plug-ins/imagemap/imap_settings.c
        * plug-ins/maze/maze.c
        * plug-ins/sel2path/curve.c
        * plug-ins/sel2path/fit.c
        * plug-ins/sel2path/pxl-outline.c
        * plug-ins/sel2path/spline.c
        * plug-ins/xjt/xjt.c: Functions with no args should be declared
        with (void).

        * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
        the compiler.
2004-11-14 02:50:33 +00:00
Michael Natterer cd7972a8c2 call gimp_image_flush() after committing the image_map so the menus are
2004-11-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
	call gimp_image_flush() after committing the image_map so the
	menus are up-to-date. Fixes bug #157914.
2004-11-11 10:16:57 +00:00
Michael Natterer 04a7e8585b added new function gimp_statusbar_push_length(), which works exactly like
2004-11-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.[ch]: added new function
	gimp_statusbar_push_length(), which works exactly like
	push_coords() but takes only one value plus a GimpOrientationType
	for specifying the value's axis.

	* app/tools/gimptool.[ch]: added the corresponding
	gimp_tool_push_status_length().

	* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
	so the guide position is shown in the selected display unit.
	Cleaned up the status message code a bit.
2004-11-10 01:17:40 +00:00
Michael Natterer 6d9a69c0a6 pass (gint)-truncated coordinates instead of RINT()-rounded ones to
2004-11-09  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
	coordinates instead of RINT()-rounded ones to
	gimp_display_shell_update_cursor(). Restores correct coordinates
	display for zoomed-in display and fixes bug #153534.

	* app/tools/gimpmovetool.c: added statusbar messages including the
	(rounded) guide coordinate. Keeps bug #141719 closed.
2004-11-09 13:03:07 +00:00
Michael Natterer 5d7b121fd7 Don't use deprecated GtkToolbar API in GimpTextEditor:
2004-11-04  Michael Natterer  <mitch@gimp.org>

	Don't use deprecated GtkToolbar API in GimpTextEditor:

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/actions/text-editor-actions.[ch]
	* app/actions/text-editor-commands.[ch]: added acions and
	callbacks for the new "text-editor" action group.

	* app/menus/menus.c: register a "<TextEditor>" UI manager.

	* menus/Makefile.am
	* menus/text-editor-toolbar.xml: new file for the toolbar.

	* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
	UI manager instead of constructing it using deprecated API.

	* app/tools/gimptextoptions.c: changed accordingly.

	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
	(used by text-editor-commands.c).
2004-11-04 14:24:32 +00:00
Michael Natterer ecc9fecfc9 added "gboolean recalc_highlight" and call
2004-11-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcroptool.c (crop_recalc): added "gboolean
	recalc_highlight" and call gimp_display_shell_set_highlight() only
	when it's TRUE. Pass TRUE from all places where the crop outline
	actually changed.

	(gimp_crop_tool_control): added back the call to crop_recalc() for
	the RESUME case so the outline gets updated on zoom/scroll, but pass
	recalc_highlight = FALSE because it has not changed.
	Fixes bug #157001.
2004-11-02 11:26:05 +00:00
Øyvind Kolås c5c0a219d9 renamed *levels-auto to *levels-stretch 2004-11-01 16:05:19 +00:00
Sven Neumann 267676fa99 app/config/gimpguiconfig.[ch] app/config/gimprc-blurbs.h
2004-10-30  Sven Neumann  <sven@gimp.org>

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/dialogs/preferences-dialog.c
	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
	Instead added a gimprc option that allows to get the old behaviour
	back.
2004-10-30 15:02:39 +00:00
Sven Neumann e4a871c10b changed default value for new "change-active" property 2004-10-30 14:16:57 +00:00
Sven Neumann 9fd4ac8a6d app/tools/gimpmoveoptions.[ch] applied (cleaned up version of) a patch
2004-10-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmoveoptions.[ch]
	* app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
	patch from Joao S. O. Bueno that adds a tool-option to restore the
	old Move tool behaviour. Fixes bug #156801.
2004-10-30 13:52:20 +00:00
Michael Natterer d0ab9a7470 app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2 bounding boxes
2004-10-27  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
	bounding boxes to x,y,width,height ones. Added
	gimp_transform_matrix_flip_free(). Renamed some parameters to be
	consistent with others. Some internal cleanup.

	* app/tools/gimpperspectivetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.

	* tools/pdbgen/pdb/drawable_transform.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: guard all transform
	wrappers with if(gimp_drawable_mask_intersect(...)), also the
	ones which don't need the returned bounding box.

	* tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
	and added gimp_drawable_transform_matrix() which takes the 9
	coefficients of a 3x3 matrix for ultimate flexibility ;)

	* app/pdb/drawable_transform_cmds.c
	* app/pdb/internal_procs.c
	* app/pdb/transform_tools_cmds.c
	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-10-27 17:56:02 +00:00
Michael Natterer 6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Simon Budig fdd150e310 Switch to design mode when Escape gets pressed. Untabbified.
2004-10-25  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Switch to design mode when
	Escape gets pressed. Untabbified.
2004-10-25 13:29:32 +00:00
Michael Natterer 6e9d0cfa5d added labels ("_Stroke") to the SLEECTION_STROKE and PATH_STROKE stock
2004-10-23  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
	SLEECTION_STROKE and PATH_STROKE stock items so they can be used
	in action areas.

	* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
	with "_Stroke" and reordered some code.

	* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
	of GTK_STOCK_OK. Added parameters to specify the dialog's title
	so it doesn't say "Stroke Options".

	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
	Path" as dialog titles.
2004-10-23 10:28:56 +00:00
Sven Neumann 43a4629965 app/tools/gimpimagemaptool.[ch] app/tools/gimpcurvestool.c allow to
2004-10-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: allow to Shift-click the Load and
	Save buttons to skip the file chooser dialog and reuse the last
	used filename. Fixes bug #75558.
2004-10-22 19:44:03 +00:00
Michael Natterer 5507c47c6d removed 3 mnemonics. No other tool options label has a mnemonic. Addresses
2004-10-19  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_gui): removed
	3 mnemonics. No other tool options label has a mnemonic.
	Addresses bug #155861.
2004-10-19 17:37:44 +00:00
Michael Natterer c49df22eef Action code review and pre-release consistency cleanup:
2004-10-18  Michael Natterer  <mitch@gimp.org>

	Action code review and pre-release consistency cleanup:

	* app/actions/*-actions.c: added some missing and resolved
	conflicting mnemonics, added missing help IDs. Cleaned up the
	*_actions_update() functions.

	* app/actions/channels-actions.c
	* app/actions/layers-actions.c
	* app/actions/vectors-actions.c (*_actions_update): simplified
	the code that figures the prev and next channel,layer,vectors.

	* app/actions/qmask-actions.c: use the same accelerator for
	"qmask-active" and "qmask-toggle". Fixed action sensitivity.

	* app/actions/channels-commands.c
	* app/actions/dockable-commands.c
	* app/actions/documents-commands.c
	* app/actions/gradients-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/image-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c: folded tons of private utility
	functions into their only callers (they used to be public and
	called from outside before the switch to action based menus).
	Renamed functions and variables saying "query" or "qbox" to
	"dialog". Moved static functions to the end of the files. Misc
	minor cleanups.

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.c: made the "drawable-visible" and
	"drawable-linked" actions affect the layer if the active drawable
	is a layer mask.

	* app/actions/select-commands.c: added action to stroke with the
	last values used in an attempt to address bug #135746 but #if 0'ed
	it because the approach is too ugly.

	* app/tools/gimpiscissorstool.c: changed mnemonic from I to S.

	* menus/image-menu-xml.in: added more stuff to the (commented out)
	"context" menu.
2004-10-18 11:29:58 +00:00
Sven Neumann 428a80a1ee removed the "Density" label. It wasn't helpful and caused the transform
2004-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c: removed the "Density" label.
	It wasn't helpful and caused the transform options to be wider than
	necessary.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptransformoptions.c: let combo boxes expand
	horizontally like we do in other (all ?) dialogs.

	* app/widgets/gimptemplateeditor.c
	(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-14 22:55:18 +00:00
Michael Natterer 27c2be7cea libgimpwidgets/gimpwidgets.c app/widgets/gimpenumwidgets.[ch]
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.c
	* app/widgets/gimpenumwidgets.[ch]
	* app/widgets/gimppropwidgets.c
	* app/actions/layers-commands.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
	not have any border width. Fixes many subtle misalignments.
2004-10-14 15:44:13 +00:00
Michael Natterer eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Michael Natterer 08bab5b31d added utility functions which create a
2004-10-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: added utility functions
	which create a GimpViewableButton+GimpContainerEntry combo for
	brushes, patterns, gradients and fonts and a very ugly utility
	function which packs one of these combos into a GtkFrame returned
	by gimp_prop_enum_radio_frame_new(). This stuff does not really
	belong here but is too ugly to be moved to a more general place.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: use the new utility functions. Moved
	the pattern previews into the radio frame where using the pattern
	is selected. Make them insensitive if using the pattern is not
	selected.
2004-10-11 13:27:42 +00:00
Michael Natterer 8a622048f3 implement GimpTool::key_press() and cancel the tool on GDK_Escape. Come
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
	cancel the tool on GDK_Escape. Come cleanup.
2004-10-08 15:32:30 +00:00
Michael Natterer 57f9d32e56 Made the text options about two toolbox grid columns smaller. Addresses
2004-10-08  Michael Natterer  <mitch@gimp.org>

	Made the text options about two toolbox grid columns smaller.
	Addresses bug #122862.

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
	the number of digits of the property's max_val plus two as number
	of chars for the sizeentry'y spinbutton (instead of always 10 as
	before).

	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
	has a minimal width of 150 pixels (eek). Set a silly small minimal
	width instead (the entry expands to the available width anyway).
2004-10-08 14:00:41 +00:00
Michael Natterer c9f9c56ce7 the gradient button in blend options got lost, added it back. Also moved
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppaintoptions-gui.c: the gradient button in blend
	options got lost, added it back. Also moved creation of the brush,
	pattern and gradient buttons to utility functions and cleaned up
	the whole file a bit.
2004-10-08 11:08:50 +00:00
Michael Natterer 76d95a10d0 added new parameter "gboolean propagate_release" to
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.[ch]: added new parameter
	"gboolean propagate_release" to gimp_edit_slection_tool_start()
	and remember it in the GimpEditSelectionTool struct. If requested,
	propagate GimpTool::button_release() to the tool below in the tool
	stack.

	* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
	pass FALSE so we don't get the button_release().

	* app/tools/gimpmovetool.[ch]: pass TRUE so we get
	button_release(). If moving a layer or path in "pick active" mode,
	remember the old active layer/path and switch back to it in
	button_release(). Fixes bug #97734.

	Unrelated:

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
	if a move actually happened. Fixes un-undoable moves at high zoom
	factors.
2004-10-06 21:04:13 +00:00
Michael Natterer 62c23a2361 reset the tool options before deserializing so they have the correct
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
	options before deserializing so they have the correct default
	values. Fixes bug #120832.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: removed all set_defaults()
	utility functions and moved their code to reset(). The change
	above calls them automatically so there is no need to call them
	from the GUI constructors any more.
2004-10-06 17:21:22 +00:00
Michael Natterer 3f2d5e68b5 Fixed the scale constraints radio buttons:
2004-10-06  Michael Natterer  <mitch@gimp.org>

	Fixed the scale constraints radio buttons:

	* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
	initialize the radio group with the correct value instead of
	resetting the model before creating the group.

	(gimp_scale_options_constrain_callback): change the model
	only if the radio button became active.

	(gimp_scale_options_constrain_notify): new callback which makes
	the radio buttons a real view on the model again (fixes GUI
	updates on modifier press/release).
2004-10-06 12:05:35 +00:00
Michael Natterer dbd941c9f7 dispatch GDK_Escape to GimpTool::key_press().
2004-10-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): dispatch GDK_Escape to
	GimpTool::key_press().

	* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
	* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
	cancel the tool on <Escape>.
2004-10-01 15:15:14 +00:00
Sven Neumann 6e8bb7ac12 destroy the info dialog instead of hiding it. Fixes session management.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (crop_response): destroy the info
	dialog instead of hiding it. Fixes session management.
2004-10-01 12:41:54 +00:00
Sven Neumann ef736c43b4 unset the highlight from crop_response() so it gets called when cropping
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: unset the highlight from
	crop_response() so it gets called when cropping is cancelled.

	* app/dialogs/info-dialog.c (info_dialog_show): do what the
	function name says, show the window, but don't present it.
	Fixes bugs #128833 and #138816.
2004-10-01 12:23:43 +00:00
Sven Neumann 297b53a466 no need to include gimpdisplayshell-render.h here.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: no need to include
	gimpdisplayshell-render.h here.

	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-render.[ch]

	* app/display/gimpdisplayshell.[ch]: added an API to highlight a
	rectangle (specified in image coordinates). Actually it doesn't
	highlight but dims the area outside the rectangle.

	* app/tools/gimpcroptool.c: use the new functionality to show the
	area to be cropped. Fixes bug #93360.
2004-10-01 09:50:04 +00:00
Sven Neumann ab1045b8a1 plugged a tiny memleak spotted by Olivier.
2004-09-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
	tiny memleak spotted by Olivier.
2004-09-29 15:40:29 +00:00
Sven Neumann 5cc2b3e5f8 simplified code and removed a compiler warning.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	simplified code and removed a compiler warning.
2004-09-28 08:23:25 +00:00
Sven Neumann d725502cff add a shortcut to the filechooser that points to the user's folder.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	add a shortcut to the filechooser that points to the user's folder.

	* app/actions/vectors-commands.c: added a file filter to the SVG
	import dialog.
2004-09-27 22:44:28 +00:00
Michael Natterer fd8931f2ea set the folder using gtk_file_chooser_set_current_folder(), not
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c
	(gimp_image_map_tool_settings_dialog): set the folder using
	gtk_file_chooser_set_current_folder(), not set_filename().
2004-09-24 14:15:38 +00:00
Sven Neumann 53ff497a93 app/base/curves.[ch] defined CURVES_NUM_POINTS and use it.
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/base/curves.[ch]
	* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.

	* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
	last control point which got initialized to (255,255) by
	curves_init(). Fixes bug #153635.

	* app/pdb/color_cmds.c: regenerated.
2004-09-24 13:39:57 +00:00
Michael Natterer ff68106bf1 app/paint/gimpairbrushoptions.c app/paint/gimpcloneoptions.c
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpairbrushoptions.c
	* app/paint/gimpcloneoptions.c
	* app/paint/gimpconvolveoptions.c
	* app/paint/gimpdodgeburnoptions.c
	* app/paint/gimperaseroptions.c
	* app/paint/gimpinkoptions.c
	* app/paint/gimppaintoptions.c
	* app/paint/gimppenciloptions.c
	* app/paint/gimpsmudgeoptions.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimphistogramoptions.c
	* app/tools/gimpimagemapoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmeasureoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptextoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c: code cleanup: untabified and
	trailing whitespace removal, removed empty instance_init()
	funcions, cleaned up variable declarations/initializations.
2004-09-24 12:01:35 +00:00
Michael Natterer db89d80cb1 app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register) add
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
	* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
	add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
	these tools use the current gradient. Fixes bug #153584.
2004-09-23 21:04:39 +00:00
Michael Natterer 10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
William Skaggs b8265901d8 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
	by my previous commit -- no functional change.
2004-09-19 19:50:09 +00:00
William Skaggs 4b8a00274c Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: rearrange tool options as
	described in bug #153014.
2004-09-19 19:15:03 +00:00
Michael Natterer 7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Simon Budig c07125554a Fix trailing whitespace introduced by me. /me hides embarrassed in a
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
	/me hides embarrassed in a corner...   :)
2004-09-13 12:02:06 +00:00
Simon Budig ef206e7fd2 Fix warnings and coding style.
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix warnings and coding style.
2004-09-13 10:10:43 +00:00
Nathan Summers 8be9e2b2be disable crop and resize buttons while the operation is being processed.
2004-09-12  Nathan Summers  <rock@gimp.org>

        * app/tools/gimpcroptool.c: disable crop and resize buttons while the
	operation is being processed.  Fixes #152372.
2004-09-13 01:45:45 +00:00
Simon Budig f7e4e55d1d reordered info_dialog_hide() and crop_tool_crop_image(), which avoids the
2004-09-06  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
	crop_tool_crop_image(), which avoids the repeated popping up
	of the info dialog and avoids a crash.

	Fixes bug #151712
2004-09-05 23:42:30 +00:00
Sven Neumann d1825782ea avoid excessive use of strdup() and strcmp(). The strings are all constant
2004-08-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
	avoid excessive use of strdup() and strcmp(). The strings are all
	constant anyway.
2004-08-30 15:08:02 +00:00
David Odin b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
Sven Neumann 7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
David Odin f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann 0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Michael Natterer da9c039eb2 removed the recently added "gdouble aspect_ratio"...
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.h: removed the recently added
	"gdouble aspect_ratio"...

	* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
2004-08-06 16:39:11 +00:00
Michael Natterer db821565e2 Transform tool cleanup:
2004-08-06  Michael Natterer  <mitch@gimp.org>

	Transform tool cleanup:

	* app/tools/gimptransformtool.[ch]: added new virtual function
	GimpTransformTool::dialog_update().
	Made wrapper for ::recalc() public and function
	transform_bounding_box() private.
	Call ::dialog_update() and transform_bounding_box() from the
	::recalc() wrapper.

	* app/tools/gimpperspectivetool.[ch]
	* app/tools/gimprotatetool.[ch]
	* app/tools/gimpscaletool.[ch]
	* app/tools/gimpsheartool.[ch]: turned all info_dialog update
	functions into GimpTransformTool::dialog_update() implementations
	and don't call them from ::recalc(), also removed calls to
	transform_bounding_box(); both functions are called by the parent
	class now. Call gimp_transform_tool_recalc() when dialog values
	were changed, not the tool's internal function.
	Moved all static variables to the instance structs.
2004-08-06 16:27:13 +00:00
Michael Natterer 42bc755ca7 applied (modified) patch from Ari Pollak which enables controlling the
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
	Pollak which enables controlling the shear direction from the
	dialog and changing the shear direction without hitting "Reset".
	Fixes bug #149467.

	Also moved all static variables to the GimpShearTool struct and
	converted tabs to spaces.
2004-08-06 13:56:34 +00:00
Michael Natterer bba0394529 increased the handle size from 8 to 9 pixels (which is the same as in the
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpiscissorstool.c: increased the handle size from 8
	to 9 pixels (which is the same as in the path tool) as suggested
	in bug #134250.
2004-08-05 15:44:34 +00:00
Michael Natterer 8db70a4c79 app/tools/gimpscaletool.c applied patch from Jordi Gay (attached to bug
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpscaletool.c
	* app/tools/gimptransformtool.h: applied patch from Jordi Gay
	(attached to bug #131111) which adds an aspect ratio spinbutton to
	the scale dialog and keeps the aspect ratio intact when with or
	height are changed using the dialog. Fixes bug #132274.

	* app/tools/gimpcroptool.c
	* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
	"wrap" and decrease their climb_rate.
2004-08-05 11:12:58 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Sven Neumann c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Michael Natterer 4b582b481a Replaced the concept of having a boolean indicating if an undo step
2004-07-29  Michael Natterer  <mitch@gimp.org>

	Replaced the concept of having a boolean indicating if an undo
	step dirties the image by a bitfield indicating which parts
	of the image are dirtied:

	* app/core/core-enums.[ch]: reordered two values in enum
	GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.

	The values of GimpDirtyMask are still questionable and will
	probably change...

	* app/core/gimpimage.[ch]: removed signal "undo_start" and added
	a GimpDirtyMask parameter to the "dirty" and "clean" signals.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
	"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
	it to gimp_image_dirty().

	(gimp_image_undo_group_start): added *ugly* code which tries to
	figure GimpDirtyMask from the group's GimpUndoType and store it in
	the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
	gimp_image_undo_start(). This means the undo group now dirties the
	image just like one of its undo steps, but that's no problem since
	undoing cleans it in the same way.

	* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g

	(gimp_undo_pop): emit clean/dirty signals *before* performing the
	actual undo step so listeners can detach from the image before it
	is changed by undo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
	GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().

	* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
	because it makes no sense to use GimpImageMap noninteractively.
	Don't freeze()/thaw() undo while the image_map is active which
	fixes many ways of trashing the image's undo state but probably
	introduces new ways of doing evil things.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell-handlers.c: changed according
	to the GimpImage::clean()/dirty() signal changes. Small fixes
	in the quit dialog's dirty image container.

	* app/tools/gimptoolcontrol.[ch]: added member and API to
	set/get the dirty_mask.

	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: whenever setting "preserve" to
	FALSE, also set a "dirty_mask" which specifies on which image
	changes the tool wants to be canceled.

	* app/tools/tool_manager.c: removed "undo_start" connection and
	connect to both "dirty" *and* "clean" to check if the active_tool
	needs to be canceled. Cancel the tool only if the dirty_mask
	passed in the signal has common bits with the tool's dirty_mask.

	Fixes bug #109561 and probably opens some new ones...
2004-07-29 14:16:21 +00:00
Michael Natterer e36039f447 app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init) don't
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
	don't call gimp_tool_control_set_preserve (tool->control, FALSE)
	because these tools don't cashe any image state and don't care
	about the image changing under their feet.
2004-07-28 16:21:00 +00:00
Michael Natterer ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Sven Neumann bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Michael Natterer caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Michael Natterer d50a2db779 renamed init_edit_selection() to gimp_edit_selection_tool_start(). Removed
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
	to gimp_edit_selection_tool_start(). Removed enum EditType.

	* app/tools/tools-enums.h: added enum GimpTranslateMode instead.

	* app/tools/gimpmovetool.c: changed accordingly.

	* app/tools/gimpselectiontool.[ch]: added protected utility
	function gimp_selection_tool_start_edit().

	* app/tools/gimpfreeselecttool.c
	* app/tools/gimpfuzzyselecttool.c
	* app/tools/gimprectselecttool.c: use the new function instead of
	duplicating the same code three times, don't include
	"gimpeditselectiontool.h".

	* app/tools/gimpiscissorstool.c: don't include
	"gimpeditselectiontool.h".
2004-07-26 14:50:51 +00:00
Michael Natterer 674f80e155 don't freeze()/thaw() the image's undo to prevent live-movement from
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
	image's undo to prevent live-movement from ending up on the undo
	stack. Instead, just stop pushing undo steps after the initial
	movement. Simplifies edit_select's undo code quite a bit and fixes
	bug #148458.
2004-07-26 13:15:22 +00:00
Michael Natterer 85c2b2dd4f removed enum GimpPaintCoreState.
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.

	* app/paint/paint-enums.h: added enum GimpPaintState (with values
	that have a name space).

	* app/paint/gimppaintcore.[ch]
	* app/paint/gimpairbrush.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimpink.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore-stroke.c
	* app/paint/gimpsmudge.c
	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpinktool.c: removed unused #include.
2004-07-19 14:37:40 +00:00
Michael Natterer fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer 54cc251b08 app/core/Makefile.am app/core/core-types.h new interface which has
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppickable.[ch]: new interface which has
	get_image_type(), get_tiles() and get_color_at() methods.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
	and removed public get_colot_at() functions.

	* app/core/gimpimage-pick-color.[ch]: removed typedef
	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
	gimp_pickable_pick_color() instead.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/gui/info-window.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
	instead of the various get_color_at() functions. Simplifies code
	which has a "sample_merged" boolean. Various cleanups.
2004-07-13 23:04:05 +00:00
Michael Natterer c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Sven Neumann 11795e78f4 plugged a tiny memory leak.
2004-07-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
	a tiny memory leak.
2004-07-13 08:59:10 +00:00
Michael Natterer a81e96450a removed member "guint time"...
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/text/gimptextundo.[ch]: removed member "guint time"...

	* app/core/gimpundo.[ch]: ...and added it here.

	* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
	accordingly. Reordered undo compression code to look like other
	pieces of code which do undo compression.
2004-07-12 17:10:34 +00:00
Michael Natterer da74f1269e app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new()
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpundo.[ch]
	* app/core/gimpitemundo.[ch]
	* app/text/gimptextundo.[ch]: removed all _new() functions and
	added properties and GObject::constructor() implementations
	instead.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
	"GType undo_gtype" parameter and allow to pass name-value pairs as
	"...". Une the new GParameter utility functions to construct the
	appropriate undo step with g_object_newv().

	(gimp_image_undo_push_item): removed.

	(gimp_image_undo_push_undo): removed. Merged its code back into
	gimp_image_undo_push(), where it originally came from.

	* app/core/gimpimage-undo-push.c
	* app/core/gimpundostack.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c
	* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 16:59:36 +00:00
Hans Breuer b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Sven Neumann 9f25f8608b adapt the arrow key velocity to the display scale factor. Please test and
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
	to the display scale factor. Please test and complain if you
	dislike this behaviour.

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-color-pick-from-screen-16.png: new
	icon drawn by Jimmac.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* libgimpwidgets/gimppickbutton.c: use it for the screen color
	picker instead of reusing the color picker tool icon.
2004-07-06 22:58:33 +00:00
Sven Neumann ef885f7691 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes bug
2004-07-06  Sven Neumann  <sven@gimp.org>

	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
	bug #145401.

	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
	it to the PDB.

	* app/base/gimphistogram.c: implemented histogram functions for
	the RGB mode.

	* app/base/levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogrameditor.c: handle the new enum value.

	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
	draw a histogram that shows the RGB channels simultaneously
2004-07-06 16:33:30 +00:00
Michael Natterer 5ce611e0d8 return TRUE if initialization was successful. Makes the tool->drawable
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
	return TRUE if initialization was successful. Makes the
	tool->drawable pointer being set correctly by the calling code and
	fixes bugs where colorize was leaving the drawable in a modified
	but non-undoable state when cancelling or changing images.
2004-07-05 12:54:58 +00:00
Simon Budig e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00
Michael Natterer 23f6a194ac added context->serialize_props mask which enables specifying exactly which
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: added context->serialize_props mask
	which enables specifying exactly which properties will be
	serialized. Also fixes a bug that prevented undefined properties
	from being serialized, breaking tool_options and device status
	serialization.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
	properties in the tool_info->context_props mask serializable, also
	configure/initialize tool_info->tool_options.

	* app/tools/gimp-tools.c (gimp_tools_register): removed
	tool_options initialization that is now done in
	gimp_tool_info_new().

	* app/widgets/gimpdeviceinfo.c: make only the properties in
	GIMP_DEVICE_INFO_CONTEXT_MASK serializable.

	* app/widgets/gimpdevicestatus.c: add the device table to its
	parent container again. Fixes "missing" devices.

	* app/core/gimptooloptions.c
	* app/widgets/gimpdevices.c: cleanup / code review.
2004-07-03 20:27:28 +00:00
Michael Natterer 04ed4a8a0f if the color tool is enabled, skip cursor hiding entirely.
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
	the color tool is enabled, skip cursor hiding entirely.
2004-07-03 13:07:30 +00:00
Philip Lafleur 1d625ed2f5 Replaced "Preview" checkbutton with a combobox with options "Outline",
2004-07-02  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformoptions.[ch]:
	* app/tools/gimptransformtool.c:
	* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
	a combobox with options "Outline", "Grid", "Image", and
	"Image + Grid".
2004-07-02 21:56:30 +00:00
Philip Lafleur bbed5b577b Chain up if the color tool is enabled. This fixes the problem of the color
2004-06-30  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
	Chain up if the color tool is enabled. This fixes the problem of
	the color picker cursor not appearing when using a paint tool
	in color picking mode while "Show Paint Tool Cursor" is off.
2004-07-01 00:12:29 +00:00
William Skaggs 8d4bdf5d60 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/*/*-enums.h: did HIG-compliant capitalization in the right
	place, instead of the auto-generated *-enums.c files.
2004-06-30 15:47:32 +00:00
Michael Natterer 4022980314 Fixed a 1.2 -> 2.0 regression that was forgotten:
2004-06-30  Michael Natterer  <mitch@gimp.org>

	Fixed a 1.2 -> 2.0 regression that was forgotten:

	* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
	which can be one of { NEW, UPDATE }.

	* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
	gimp_palette_editor_update_color() to
	gimp_palette_editor_pick_color() and restored the functionality of
	creating/updating colors via this API

	Changed button_press handler to only edit the color on double
	click if it's really a double click on the same color.
	Fixes bug #141381.

	* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
	"add-to-palette" and a GUI for it.

	* app/core/gimpmarshal.list
	* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
	parameter to the "color_picked" signal. Pass NEW on button_press
	and UPDATE on motion.

	* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
	* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
	* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
	changed accordingly

	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
	If "add-to-palette" is TRUE, get the palette editor and call
	gimp_palette_editor_pick_color().
2004-06-30 12:10:08 +00:00
Michael Natterer d61cc35ec0 fix typo in last commit. 2004-06-28 23:42:21 +00:00
Michael Natterer 6cd5737257 added new function gimp_get_mod_string() which takes a GdkModifierType and
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_get_mod_string() which takes a GdkModifierType and returns
	correctly formated strings for all shift,control,alt combinations.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: use the new function instead
	of gimp_get_mod_name_shift(),control(),alt(),separator(). This
	kindof addresses the issue of configurable modifier keys but is
	actually indended to ease translation of format strings ("%s" is
	easier to get right than "%s%s%s").
2004-06-28 23:30:57 +00:00
Michael Natterer a2850f6df2 Fixed bug #141930 while keeping bug #132322 fixed:
2004-06-28  Michael Natterer  <mitch@gimp.org>

	Fixed bug #141930 while keeping bug #132322 fixed:

	* app/base/curves.c (curves_lut_func)
	* app/base/levels.c (levels_lut_func): changed meaning of channel
	slots for GRAYA images: just as for GRAY images, expect the value
	channel in slot 0 and the alpha channel in slot 1, so it matches
	the meaning of slots of GimpHistogram (before this change, only
	GRAY images had their value in slot 0 and GRAYA images had it in
	slot 1, whereas the histogram had the value channel in slot 0,
	which was breaking auto levels for GRAYA images).

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
	and GRAYA images accordingly.

	* app/tools/gimpcurvestool.c (curves_update)
	* app/tools/gimplevelstool.c (levels_update): call
	gimp_color_bar_set_buffers() with the right buffers.

	* app/pdb/color_cmds.c: regenerated.
2004-06-28 14:24:56 +00:00
Sven Neumann b9c23cac5d select the standard tool.
2004-06-28  Sven Neumann  <sven@gimp.org>

	* app/gui/gui.c (gui_initialize_after_callback): select the
	standard tool.

	* app/tools/tool_manager.c: cosmetics.
2004-06-28 13:18:00 +00:00
Michael Natterer 3ec1647d36 reverted fix for bug #141930. These hacks are there because the enum used
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
	hacks are there because the enum used in levels doesn't match
	the enum used by the combo box and the histogram widget.
2004-06-28 11:45:14 +00:00
Michael Natterer c186126083 removed again (tools must not draw outside GimpDrawTool::draw()).
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
	removed again (tools must not draw outside GimpDrawTool::draw()).

	(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
	because the draw function would not be called if the draw tool was
	inactive. Simplified check for whether or not to draw the src
	location.

	* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
	pause/resume the draw tool across all button_release actions so
	tools (clone) have a chance to draw different things depending on
	gimp_tool_control_is_active(tool->control). Fixes bug #145022.
2004-06-28 11:36:00 +00:00
Simon Budig 96e8b93e2a fixed drawing code to properly update after deleting nodes via
2004-06-28  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: fixed drawing code to properly
	update after deleting nodes via BackSpace/Delete.
2004-06-27 23:00:46 +00:00
William Skaggs d6428d61ab Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimplevelstool.c: removed two small chunks of code.
	Fixes bug #141930.  Possibly unfixes bug #132322.
2004-06-27 17:30:55 +00:00
William Skaggs 47ec8205cd Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpclonetool.c: added button_release callback
	to fix bug #145022.
2004-06-26 23:45:13 +00:00
Michael Natterer 02b91f6628 app/tools/gimptool.[ch] added boolean return value to
2004-06-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: added boolean return value to
	GimpTool::key_press() which indicates if the event was handled.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.[ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: return TRUE if the key event was handled.

	* app/tools/gimppainttool.c: removed key_press() implementation.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
	which takes GdkEventKey and emits controller events for all
	combinations of modifiers and cursor keys.

	* app/widgets/gimpcontrollers.[ch]: added new function
	gimp_controllers_get_keyboard().

	* app/display/gimpdisplayshell-callbacks.c: if a key event was not
	handled by the active tool, dispatch it to the keyboard controller.

	* etc/controllerrc: add a keyboard controller which is configured
	to do the same as the removed gimp_paint_tool_key_press().
2004-06-24 10:16:08 +00:00
William Skaggs b4197cf30e Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/*.c: HIGify capitalization for dialogs.  More
	progress on bug #123699.
2004-06-23 20:29:46 +00:00
Michael Natterer 7e52ed902a added signal "set-brush" which is G_SIGNAL_RUN_LAST so we can connect
2004-06-23  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
	G_SIGNAL_RUN_LAST so we can connect before and after the default
	implementation. Moved the brush setting and outline invalidation
	stuff to its default implementation. Also remember the outline's
	width and height. Call gimp_brush_core_set_brush() from
	gimp_brush_core_invalidate_cache() so "set-brush" is emitted
	whenever a generated brush becomes dirty.

	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
	pause/resume but rather stop/start the draw_tool. Fixes straight
	line preview aretefacts.

	(gimp_paint_tool_oper_update): set the brush_core's brush before
	starting the draw_tool.

	(gimp_paint_tool_draw): never free the brush_core's cached brush
	outline because the brush_core does that by itself now.

	(gimp_paint_tool_set_brush)
	(gimp_paint_tool_set_brush_after): new callbacks which pause and
	resume the draw_tool. Fixes brush outline artefacts when modifying
	the current brush e.g. by using the mouse wheel.
2004-06-23 12:19:28 +00:00
William Skaggs 546359f914 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpcurvestool.c: try again to revert.
2004-06-22 21:09:26 +00:00
Bill Skaggs 848307668e added Store/Recall buttons for one-click saving and loading of curves.
2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>

	* app/tools/gimpcurvestool.c: added Store/Recall buttons for
	one-click saving and loading of curves.  Should create stock
	labels for them.  Hopefully resolves bug #75558.
2004-06-22 17:17:16 +00:00
Michael Natterer afeaf96dd5 chain up unconditionally now that we draw the brush outline while
2004-06-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
	unconditionally now that we draw the brush outline while
	painting. Fixes brush outline artefacts on button_press and
	button_release. Spotted by sjburges.
2004-06-22 15:31:14 +00:00
William Skaggs 8a7e2703dc Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimptransformoptions.c: use radio buttons
	for constraint options.  Makes all options visible,
	should resolve bug #68106.
2004-06-22 02:21:13 +00:00
Sven Neumann d97fb0a287 removed the label between the spinbuttons, it looks silly. Converted tabs
2004-06-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrambox.[ch]: removed the label between the
	spinbuttons, it looks silly. Converted tabs to spaces, removed
	trailing whitespace.

	* app/widgets/gimphistogrameditor.c
	* app/tools/gimpthresholdtool.c: changed accordingly.
2004-06-20 22:04:10 +00:00
William Skaggs ca7aac79d1 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrambox.[ch]:
	* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
	so that it uses a two-triangle-slider scale of the sort used in the
	levels tool.  Almost all of the changes are actually in the
	histogram-box widget code, which is only used by the threshold
	tool.  Fixes bug #137521.
2004-06-20 20:51:23 +00:00
Bill Skaggs 8ec615926e fixed my fix for bug # 68106, which worked incorrectly for two of the
2004-06-19 Bill Skaggs  <weskaggs@primate.ucdavis.edu>

	* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
	worked incorrectly for two of the control points.
2004-06-19 18:40:51 +00:00
William Skaggs 5180d547d0 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpscaletool.c: changed algorithm for scaling when
	aspect ratio is constrained, to fix strange behavior described
	in bug # 68106.
2004-06-18 23:07:23 +00:00
Philip Lafleur 31fd87873b reverted my fix to bug #144570.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
2004-06-18 10:47:07 +00:00
Philip Lafleur f6c502b40b Fix fuzzy select menu label.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
2004-06-18 09:48:44 +00:00
Philip Lafleur 860d29d09c If transforming a path, use the path bounds rather than the mask bounds.
2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
	If transforming a path, use the path bounds rather than the mask
	bounds. Fixes bug #144570.
2004-06-18 05:47:44 +00:00
Philip Lafleur d1e706484c Force aspect ratio to match selection when 'From Selection' is clicked.
2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimpcroptool.c (crop_selection_callback): Force
	aspect ratio to match selection when 'From Selection' is clicked.
	Fixes bug #144361. Also converted tabs to spaces.
2004-06-15 15:30:36 +00:00
Michael Natterer 587e070ff4 removed PRETRACE_PAINT and POSTTRACE_PAINT from the GimpPaintCoreState
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
	POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
	"gboolean traces_on_window" from GimpPaintCoreClass.

	* app/paint/gimpclone.[ch]
	* app/paint/gimpink.c
	* app/tools/gimpclonetool.c: changed accordingly.

	* app/tools/gimppainttool.c: ditto. Show the brush outline
	while painting. Fixes bug #118348.
2004-06-14 15:26:29 +00:00
Michael Natterer 4b9a4db275 use gimp_draw_tool_is_active() instead of
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
	instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
2004-06-14 15:13:37 +00:00
Philip Lafleur 905b0e031e Disable preview in corrective mode, and notify preview when switching
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: Disable preview in corrective
	mode, and notify preview when switching transform type and
	direction.
2004-06-14 13:21:29 +00:00
Michael Natterer 3e2690832c added new virtual function GimpPaintCore::post_paint() and call it after
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: added new virtual function
	GimpPaintCore::post_paint() and call it after calling
	GimpPaintCore::paint().

	* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
	to brush_core->main_brush and reset brush_core->brush
	to brush_core->main_brush in GimpPaintCore::post_paint().

	* app/paint/gimpbrushcore.c
	* app/paint/gimppaintcore-stroke.c
	* app/tools/gimppainttool.c: removed all code which restores
	the brush_core's old brush after painting since post_paint()
	does this automatically now.

	* app/paint/gimpclone.[ch]: moved static variables to the
	GimpClone struct.
2004-06-14 12:52:33 +00:00
Philip Lafleur 4ad2d7177f Preview is now only used for layer transformations.
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c: Preview is now only used for
	layer transformations.
2004-06-14 11:45:45 +00:00
Michael Natterer 4c68bd878a app/tools/gimpperspectivetool.c app/tools/gimprotatetool.c
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c: removed calls to
	gimp_transform_tool_expose_preview() from all
	GimpTransformTool::motion() implementations...

	* app/tools/gimptransformtool.c: ...and call it after calling
	tr_tool_class->preview().
2004-06-14 10:48:00 +00:00
Michael Natterer 1082ee6b94 remember the last used GimpCursorFormat so changing the format in prefs
2004-06-14  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.[ch]: remember the last used
	GimpCursorFormat so changing the format in prefs applies
	instantly, and not after the next tool change.

	* app/display/gimpdisplayshell-cursor.[ch]
	* app/tools/gimptool.[ch]
	* app/tools/gimptoolcontrol.[ch]
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolortool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
2004-06-14 10:19:39 +00:00
Philip Lafleur 71b4d89167 Preview wasn't being turned off before performing a transformation. Also
2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
	wasn't being turned off before performing a transformation. Also
	converted tabs to spaces.
2004-06-14 09:06:28 +00:00
Simon Budig a3936388bc Minor tweaks to two macros. Shouldn't change anything.
2004-06-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
	Shouldn't change anything.
2004-06-13 12:48:40 +00:00
Michael Natterer 2498adc5f6 added enum GimpCursorFormat which can be one of { BITMAP, PIXBUF,
2004-06-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
	which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
	work around broken X servers.

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.

	* app/gui/preferences-dialog.c: added a GUI for the new option.

	* app/widgets/gimpcursor.[ch]: added cursor_format parameter
	to gimp_cursor_new() and _set().

	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimpcurvestool.c
	* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
2004-06-13 02:08:54 +00:00
Philip Lafleur afb3f5c16c Fixed incorrect logic that caused perfect-but-slow pointer tracking to be
2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
	caused perfect-but-slow pointer tracking to be used in tools that
	don't request exact mode.

	* app/display/Makefile.am:
	* app/display/gimpdisplayshell-appearance.[ch]:
	* app/display/gimpdisplayshell-callbacks.c:
	* app/display/gimpdisplayshell.[ch]:
	* app/display/gimpdisplayshell-preview.[ch]: added
	* app/tools/gimpperspectivetool.c:
	* app/tools/gimprotatetool.c:
	* app/tools/gimpscaletool.c:
	* app/tools/gimpsheartool.c:
	* app/tools/gimptransformoptions.[ch]:
	* app/tools/gimptransformtool.[ch]: Implemented live transformation
	previews, available through tool options. Fixes bug #108172.
2004-06-13 01:37:29 +00:00
Simon Budig d76b2183aa Make Enter/Return apply the transformation, Backspace/Delete resets the
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimptransformtool.c: Make Enter/Return apply the
	transformation, Backspace/Delete resets the transformation.

	* app/tools/gimpcroptool.c: Simplify the key_press callback.
2004-06-12 20:10:40 +00:00
Simon Budig 3fe1753e1a Make the Enter/Return key do the crop action.
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Make the Enter/Return key do
	the crop action.

	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpvectortool.c: Make the _key_press functions
	safe for non-arrow keys.
2004-06-12 19:29:50 +00:00
Simon Budig 3c1b7fe68f renamed the "arrow_key" member to "key_press", since it is now no longer
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/gimptool.[ch]: renamed the "arrow_key" member
	to "key_press", since it is now no longer about just the arrow
	keys.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpeditselectiontool.h
	* app/tools/gimpmovetool.c
	* app/tools/gimppainttool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptexttool.c
	* app/tools/gimpvectortool.c
	* app/tools/tool_manager.c: Changed accordingly.
2004-06-12 18:41:52 +00:00
Simon Budig 39614b34a6 renamed tool_manager_arrow_key_active to tool_manager_key_press_active.
2004-06-12  Simon Budig  <simon@gimp.org>

	* app/tools/tool_manager.[ch]: renamed
	tool_manager_arrow_key_active to tool_manager_key_press_active.

	* app/display/gimpdisplayshell-callbacks.c: Also dispatch
	GDK_Return/KP_Enter/BackSpace/Delete to the tools "arrow_key"
	member of GimpTool probably should be renamed.

	* app/tools/gimpvectortool.c: Use Enter/Return to convert the
	current path to a selection, use Backspace/Delete to delete the
	currently active anchors in a path.

	Implemented on Jimmacs request - thanks for being a great host  :)
2004-06-12 18:03:48 +00:00
Philip Lafleur 234cb4c61c renamed all "pressure-pressure" variables to "pressure-hardness".
2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
	variables to "pressure-hardness".

	* app/paint/gimpairbrush.c:
	* app/tools/gimppaintoptions-gui.c: changed accordingly.
2004-06-12 12:44:24 +00:00
Sven Neumann beae166d54 no need request GIMP_MOTION_MODE_EXACT here since the parent class does
2004-06-09  Sven Neumann  <sven@gimp.org>

	* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need
	request GIMP_MOTION_MODE_EXACT here since the parent class does
	that already.

	* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
	color picker feature for the ink tool.
2004-06-09 12:14:55 +00:00
Michael Natterer 714d63fcda cursors/Makefile.am cursors/cursor-none.png new empty cursor images.
2004-06-05  Michael Natterer  <mitch@gimp.org>

	* cursors/Makefile.am
	* cursors/cursor-none.png
	* cursors/xbm/cursor-none.xbm: new empty cursor images.

	* app/config/gimpdisplayconfig.[ch]
	* app/config/gimprc-blurbs.h
	* app/widgets/widgets-enums.h
	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimppainttool.[ch]
	* app/tools/gimpinktool.c
	* app/gui/preferences-dialog.c: applied patches from Philip
	Lafleur which implement hiding the cursor completely for paint
	tools. Changed the name of the config option from
	"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
	to TRUE because this needs the brush outline being visible while
	painting to be really usable. Fixes bug #132163.

	* app/widgets/widgets-enums.h: renamed all GimpCursorType and
	GimpToolCursorType enum values to GIMP_CURSOR_* and
	GIMP_TOOL_CURSOR_*.

	* app/widgets/gimpcursor.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-cursor.c
	* app/tools/gimp*tool.c; changed accordingly.
2004-06-04 23:08:29 +00:00
Sven Neumann de1ed0a379 allow to move a text layer using the cursor keys.
2004-06-04  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
	move a text layer using the cursor keys.
2004-06-04 17:51:32 +00:00
Sven Neumann 62b59db976 app/display/gimpdisplayshell-scale.c app/gui/info-window.c
2004-06-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
	consistency and better HIG compliance.
2004-06-02 17:56:02 +00:00
Sven Neumann c509204b7d tools/pdbgen/pdb/image.pdb app/pdb/image_cmds.c reverted changes I did to
2004-06-01  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/image.pdb
	* app/pdb/image_cmds.c
	* app/core/gimpimage.[ch]: reverted changes I did to the image
	unit earlier. As in 2.0, it will continue to not accept pixels.
	This makes the PDB API and the XCF format compatible again and
	fixes bug #142961 (and to some extent bug #137704).

	* app/core/Makefile.am
	* app/core/gimpimage-unit.[ch]: removed these files. The
	convenience accessors defined here aren't commonly used any
	longer.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell.[ch]: added a unit parameter to
	gimp_display_new(). Made "unit" and "scale" properties of
	GimpDisplayShell.

	* app/actions/image-commands.c
	* app/actions/images-commands.c
	* app/actions/layers-commands.c
	* app/actions/select-commands.c
	* app/actions/view-commands.c
	* app/core/gimp-edit.c
	* app/core/gimp.[ch]
	* app/core/gimptemplate.c
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpstatusbar.c
	* app/file/file-open.c
	* app/gui/gui-vtable.c
	* app/gui/info-window.c
	* app/gui/offset-dialog.c
	* app/gui/resize-dialog.[ch]
	* app/pdb/display_cmds.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectselecttool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/vectors/gimpvectors-export.c
	* app/widgets/gimptoolbox-dnd.c
	* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
	display unit where the image unit was used before.
2004-06-01 22:04:20 +00:00
Sven Neumann 4c03f0156c app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainerentry.[ch]: added new widget
	GimpContainerEntry, a GtkEntry with completion that implements the
	GimpContainerView interface.

	* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
	GimpContainerEntry to select the font.
2004-05-31 17:53:25 +00:00
Sven Neumann e0ebd94ee9 app/paint/gimpconvolve.c app/paint-funcs/paint-funcs.[ch] reverted last
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/paint/gimpconvolve.c
	* app/paint-funcs/paint-funcs.[ch]
	* app/tools/gimpiscissorstool.c: reverted last change and applied
	new patch instead (bug #72878).
2004-05-31 10:36:06 +00:00
Sven Neumann 727ed840ab app/paint/gimpconvolve.c app/paint-funcs/paint-funcs.[ch] applied a patch
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/paint/gimpconvolve.c
	* app/paint-funcs/paint-funcs.[ch]
	* app/tools/gimpiscissorstool.c: applied a patch from Philip
	Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
2004-05-31 07:45:50 +00:00
Michael Natterer afb57d59bf app/paint/gimpbrushcore.c app/paint/gimpdodgeburn.c
2004-05-28  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpbrushcore.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimppaintcore.[ch]
	* app/tools/gimpairbrushtool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimpinktool.c
	* app/tools/gimppaintbrushtool.c
	* app/tools/gimppenciltool.c
	* app/tools/gimpsmudgetool.c: code review / cleanup.
2004-05-28 09:34:13 +00:00
Michael Natterer 23cfde41ba removed enum GimpPaintCoreFlags and member GimpPaintCore::flags. Added
2004-05-27  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
	and member GimpPaintCore::flags. Added "gboolean traces_on_window"
	to GimpPaintCoreClass (defaults to FALSE).

	* app/paint/gimpclone.c: set traces_on_window = TRUE.

	* app/paint/gimpbrushcore.[ch]: added
	"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
	to FALSE).

	* app/paint/gimpclone.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.

	* app/tools/gimppainttool.c: changed accordingly.
2004-05-27 20:48:49 +00:00
Michael Natterer b9d74b9aa4 added "guint32 time" parameters to GimpPaintCore::paint() and
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
	to GimpPaintCore::paint() and ::interpolate().

	* app/paint/gimpairbrush.c
	* app/paint/gimpbrushcore.c
	* app/paint/gimpclone.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpdodgeburn.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/paint/gimpsmudge.c: changed accordingly.

	* app/paint/gimpink.c: ditto and use the passed time instead of
	hardcoded dummy values.

	* app/paint/gimppaintcore-stroke.c: pass '0' as time.

	* app/tools/gimppainttool.c: pass the GdkEvent time.
2004-05-26 16:13:53 +00:00
Michael Natterer 5e07ceb851 app/paint/Makefile.am app/paint/gimpink-blob.[ch] app/paint/gimpink.[ch]
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/gimpink-blob.[ch]
	* app/paint/gimpink.[ch]
	* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
	to be a direct GimpPaintCore subclass without any GUI.

	* app/paint/gimp-paint.c: register GimpInk with the list of paint
	cores.

	* app/tools/Makefile.am
	* app/tools/gimpinkoptions.[ch]
	* app/tools/gimpinktool-blob.[ch]: removed these files.

	* app/tools/gimpinkoptions-gui.[ch]: new files containing only
	the GUI for GimpInkOptions.

	* app/tools/gimpinktool.[ch]: reduced to some few lines which
	implement a simple GimpPaintTool subclass.

	* app/tools/gimp-tools.c: associate the GimpInk paint_core with
	the GimpInkTool.
2004-05-26 15:34:45 +00:00
Sven Neumann c0783a91dc app/display/gimpdisplayshell-layer-select.c app/display/gimpprogress.c
2004-05-26  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpprogress.c
	* app/gui/brush-select.c
	* app/gui/color-notebook.c
	* app/gui/convert-dialog.c
	* app/gui/font-select.c
	* app/gui/gradient-select.c
	* app/gui/info-dialog.c
	* app/gui/offset-dialog.c
	* app/gui/palette-select.c
	* app/gui/pattern-select.c
	* app/gui/stroke-dialog.c
	* app/gui/tips-dialog.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpcolordisplayeditor.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
2004-05-26 13:39:23 +00:00
Michael Natterer 552fc7a519 don't do special stuff if a virtual function doesn't exist. Instead, added
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimppaintcore.c: don't do special stuff if a virtual
	function doesn't exist. Instead, added default implementations
	which do the special stuff and call the virtual functions
	unconditionally.

	* app/tools/gimppainttool.c: some stylistic cleanup.
2004-05-26 12:55:10 +00:00
Michael Natterer 080b503fd0 check if the GimpPaintCore really is a GimpBrushCore before catsting and
2004-05-26  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
	if the GimpPaintCore really is a GimpBrushCore before catsting and
	fiddling with internaly.
2004-05-26 08:45:59 +00:00
Michael Natterer 9a41a73de8 app/paint/Makefile.am app/paint/gimpbrushcore-kernels.h new GimpPaintCore
2004-05-25  Michael Natterer  <mitch@gimp.org>

	* app/paint/Makefile.am
	* app/paint/gimpbrushcore-kernels.h
	* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
	containing all the brush painting specific stuff.

	* app/paint/gimppaintcore-kernels.h: removed this file.

	* app/paint/gimppaintcore.[ch]: removed all brush stuff.

	* app/paint/gimpairbrush.c
	* app/paint/gimpclone.[ch]
	* app/paint/gimpconvolve.[ch]
	* app/paint/gimpdodgeburn.[ch]
	* app/paint/gimperaser.[ch]
	* app/paint/gimppaintbrush.[ch]
	* app/paint/gimppencil.c
	* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
	classes which used to derive directly from GimpPaintCore from
	GimpBrushCore now. Lots of cleanup.

	* app/paint/paint-types.h
	* app/paint/gimp-paint.c
	* app/paint/gimppaintcore-stroke.c
	* app/tools/gimppainttool.c
	* tools/kernelgen.c: changed accordingly.
2004-05-25 20:41:09 +00:00
Michael Natterer 1c62ddef4d Long overdue core container cleanup:
2004-05-24  Michael Natterer  <mitch@gimp.org>

	Long overdue core container cleanup:

	* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
	properties and merged the resp. code from GimpDataList into
	GimpList. Removed "policy" parameters from gimp_list_new() and
	added "unique_names". Added new constructor gimp_list_new_weak().
	Made public function gimp_list_uniquefy_name() private.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpdatalist.[ch]: removed. Its functionality is
	entirely in GimpList now.

	* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
	used to live in GimpDataList.

	* app/core/gimp.c
	* app/core/gimpdatafactory.c
	* app/core/gimpimage.c
	* app/core/gimptoolinfo.c
	* app/core/gimpundostack.c
	* app/paint/gimp-paint.c
	* app/tools/gimp-tools.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimpundoeditor.c: changed list creation accordingly.

	Made gimp->templates, gimp->named_buffers, tool_info->presets and
	the image's lists of layers, channels and vectors automatically
	ensure unique names.

	* app/widgets/gimptemplateview.c
	* app/actions/file-commands.c
	* app/actions/templates-commands.c
	* app/actions/tool-options-commands.c: removed calls to
	gimp_list_uniquefy_name().

	* app/core/gimpitem.c: removed major insanity where the items
	themselves where ensuring their unique names. Bah!

	* app/core/gimplayer.c (gimp_layer_name_changed): chain up
	conditionally.

	* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
	because there is no need any more to keep the parent
	implementation from being invoked.
2004-05-24 10:49:34 +00:00
Henrik Brix Andersen 58e6a476ab added plug-ins/MapObject/mapobject_apply.c and plug-ins/maze/maze.h. Fixes
2004-05-23 Henrik Brix Andersen <brix@gimp.org>

* po-plugins/POTFILES.in: added plug-ins/MapObject/mapobject_apply.c
and plug-ins/maze/maze.h. Fixes part of bug #142996

* app/config/gimprc-blurbs.h
* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
* plug-ins/gimpressionist/orientation.c (create_orientationpage)
* plug-ins/common/diffraction.c (diffraction_dialog)
* plug-ins/common/bumpmap.c (bumpmap_dialog)
* plug-ins/maze/maze.h
* plug-ins/MapObject/mapobject_apply.c (compute_image)
* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
strings for translation, corrected small typos. Fixes part of bug
#142996
2004-05-23 12:43:13 +00:00
Michael Natterer 6f1f65d514 made the "visible" property serializable.
2004-05-18  Michael Natterer  <mitch@gimp.org>

	* app/core/gimptoolinfo.c: made the "visible" property serializable.

	* app/tools/gimp-tools.c: store the tools' order and visibility
	in a new config file called "toolrc".
2004-05-18 12:23:56 +00:00
Sven Neumann 2dcc7ccdfd fixed position of vertical line indicating the picked color. Patch from
2004-05-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c: fixed position of vertical line
	indicating the picked color. Patch from William Skaggs and
	Søren Wedel Nielsen; fixes bug #142506.
2004-05-15 13:11:07 +00:00
Sven Neumann 6750667d87 libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal) left-align
2004-05-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
	* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
	left-align the label.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/qmask-commands.c
	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell-scale.c
	* app/gui/brush-select.c
	* app/gui/file-new-dialog.c
	* app/gui/info-dialog.c
	* app/gui/info-window.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
	by the HIG.
2004-05-12 11:37:21 +00:00
Michael Natterer de7a940501 app/config/gimpconfig-deserialize.c app/config/gimpscanner.c
2004-05-12  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-edit.c
	* app/core/gimpchannel-combine.c
	* app/core/gimpcontainer.c
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpdrawable-combine.c
	* app/core/gimpdrawable.c
	* app/core/gimpgradient.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-projection.c
	* app/core/gimpimage.c
	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpprogress.c
	* app/gui/info-dialog.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/plug-in/plug-in.c
	* app/tools/gimpdrawtool.c
	* app/tools/tool_manager.c
	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpdialogfactory.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemfactory.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpwidgets-utils.c
	* app/xcf/xcf-save.c
	* libgimp/gimpexport.c
	* libgimpwidgets/gimphelpui.c
	* libgimpwidgets/gimppixmap.c
	* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
	G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
	g_warning()s by G_STRFUNC.
2004-05-12 08:13:33 +00:00
Sven Neumann 486ccb33d7 app/tools/gimpmagnifyoptions.[ch] applied a patch from William Skaggs that
2004-05-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpmagnifyoptions.[ch]
	* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
	that changes a misleading option label. Fixes bug #137508.
2004-05-10 17:02:20 +00:00
Michael Natterer da0de0873f Started making the toolbox configurable. Addresses bug #105764. Not
2004-05-10  Michael Natterer  <mitch@gimp.org>

	Started making the toolbox configurable.
	Addresses bug #105764. Not finished yet.

	* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
	and made it a GObject property.

	* app/tools/gimp-tools.[ch]: added new function
	gimp_tools_get_default_order() which returns a GList of tool
	identifiers.

	* app/actions/tools-actions.c
	* app/actions/tools-commands.[ch]: added actions & callbacks for
	toggling the "visible" boolean and for resetting all tools.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimptoolview.[ch]: new widget which allows to
	toggle a tool's visibility and to reorder the tools.

	* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
	and pack all tool buttons into the same wrap box. Connect to
	"reoder" of the tool container and to "notify::visible" of all
	tool infos and update the toolbox accordingly.

	* app/gui/dialogs-constructors.c: create a GimpToolView for the
	tools list/grid.

	* app/menus/menus.c: register a <Tools> menu for the dialog above.

	* menus/Makefile.am
	* menus/tools-menu.xml: added the menu.
2004-05-10 00:41:57 +00:00
Michael Natterer 6bed69024f removed action "select-by-color".
2004-05-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/select-actions.c: removed action "select-by-color".

	* app/tools/gimpbycolorselecttool.c: add the shortcut here.

	* app/actions/tools-actions.c: added alternative tool actions for
	"by-color-select" and "rotate" which are identical to the ones
	generated from the GimpToolInfo except for their label. Make sure
	they have the same accelerators as the generated ones.

	* menus/image-menu.xml.in: use the alternative actions for
	"<Image>/Select/By Color" and
	"<Layer>/Transform/Arbitrary Rotation...".
2004-05-05 01:17:23 +00:00
Sven Neumann 58bcea08cc added construct properties to make it possible to derive from
2004-05-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: added construct properties to
	make it possible to derive from GimpViewableDialog.

	* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
	object, not just a convenience constructor.

	* themes/Default/gtkrc
	* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
	the action area of tool dialogs.

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
	pixels on tool dialogs to make them more compact.
2004-05-05 00:01:19 +00:00
Sven Neumann 97dd0a8e65 app/gui/info-dialog.c app/tools/gimpcolorbalancetool.c
2004-05-05  Sven Neumann  <sven@gimp.org>

	* app/gui/info-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.

	* app/widgets/gimptexteditor.c: tweaked.
2004-05-04 22:33:52 +00:00
Sven Neumann 6fd0eeac65 app/tools/gimpblendoptions.c app/tools/gimpbucketfilloptions.c
2004-05-04  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpinkoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptooloptions-gui.c
	* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
	was used. Put "Pressure Sensitivity" frame into a GtkExpander.
2004-05-04 21:11:06 +00:00
Michael Natterer 29e4cf347b Fix bug #141719:
2004-05-04  Michael Natterer  <mitch@gimp.org>

	Fix bug #141719:

	* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
	instead of ROUND() to round double coords to guide positions.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
	coords to gimp_display_shell_update_cursor() instead of implicitly
	truncating by casting to int.
2004-05-04 13:09:39 +00:00
Michael Natterer c7a7196b56 Treat FG/BG just like all other context properties:
2004-05-04  Michael Natterer  <mitch@gimp.org>

	Treat FG/BG just like all other context properties:

	* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
	and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
	that they are used by GimpPaintOptions (automatically affects all
	paint tools).

	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
	manually here.

	* app/tools/tool_manager.c (tool_manager_tool_changed): decide
	about the globality of FG and BG at the same place where we decide
	about the brush's, pattern's etc. globality, but hardcode them to
	global = TRUE instead of looking at GimpConfig.

	Fixes bug #141786.
2004-05-04 11:26:22 +00:00
Pedro Gimeno c8d982c1bf Cleanups. (gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
2004-04-30  Pedro Gimeno  <pggimeno@wanadoo.es>

	* app/tools/gimprectselecttool.c: Cleanups.
	(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
	bug #138103, which led to bug #140649.

	* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
	compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
2004-04-30 19:14:37 +00:00
Michael Natterer 2a84015e39 stripped the menu paths from the "menu_path". Will be renamed to
2004-04-29  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
	paths from the "menu_path". Will be renamed to "action_name" or
	something soon...

	* plug-ins/dbbrowser/dbbrowser.c
	* plug-ins/common/plugindetails.c
	* plug-ins/common/uniteditor.c: register under the new
	"Extensions" placeholder.
2004-04-29 13:19:28 +00:00
Michael Natterer 4654280114 Switch from GtkItemFactory to GtkUIManager. The migration is almost
2004-04-29  Michael Natterer  <mitch@gimp.org>

	Switch from GtkItemFactory to GtkUIManager. The migration is
	almost complete, still stuff missing/incomplete, definitely added
	a bunch of new bugs...

	* app/actions/*-commands.[ch]: converted all callback from
	GtkItemFactory callbacks to GtkAction callbacks.

	* app/actions/debug-actions.c
	* app/actions/gradient-editor-actions.c
	* app/actions/help-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/qmask-actions.c
	* app/actions/tool-options-actions.c: various fixes.

	* app/display/gimpdisplay.[ch]
	* app/display/gimpdisplayshell-appearance.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.[ch]: move everything from
	GtkItemFactory to GtkUIManager.

	* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
	Needed because the action callbacks don't have a widget parameter
	and sometimes we need a parent window for showing dialogs.

	* app/gui/Makefile.am
	* app/gui/brushes-menu.[ch]
	* app/gui/buffers-menu.[ch]
	* app/gui/channels-menu.[ch]
	* app/gui/colormap-editor-menu.[ch]
	* app/gui/dialogs-menu.[ch]
	* app/gui/documents-menu.[ch]
	* app/gui/error-console-menu.[ch]
	* app/gui/fonts-menu.[ch]
	* app/gui/gradient-editor-menu.[ch]
	* app/gui/gradients-menu.[ch]
	* app/gui/images-menu.[ch]
	* app/gui/layers-menu.[ch]
	* app/gui/palette-editor-menu.[ch]
	* app/gui/palettes-menu.[ch]
	* app/gui/patterns-menu.[ch]
	* app/gui/qmask-menu.[ch]
	* app/gui/templates-menu.[ch]
	* app/gui/vectors-menu.[ch]: removed these files.

	* app/gui/gui.c: create a global UI manager for the image popup
	menu and the toolbox menubar.

	* app/gui/menus.[ch]: removed all GtkItemFactory code.

	* app/gui/image-menu.[ch]
	* app/gui/toolbox-menu.[ch]: removed everything except the trivial
	setup_funcs.

	* app/gui/file-open-menu.c
	* app/gui/file-save-menu.c
	* app/gui/tool-options-menu.c: don't use the macros from menus.h
	any more, they are gone.

	* app/gui/gui-vtable.c
	* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
	menu entries.

	* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
	gimp_ui_manager_update/g

	* app/widgets/gimpuimanager.[ch]: added API to get an action
	group by name.

	* app/widgets/gimpmenufactory.c: don't choke on the item_factory
	entries being NULL.

	* app/widgets/gimpactiongroup.c: make sure booleans set using
	g_object_set() only have TRUE or FALSE values.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdockable.[ch]
	* app/widgets/gimpdocked.[ch]
	* app/widgets/gimpeditor.[ch]
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
	code and enable the #if 0'ed UI manager stuff.

	* menus/gradient-editor-menu.xml: fixed typos.

	* menus/image-menu.xml: duplicate everything so we have both
	an image menubar and an image popup menu. Badly cries for an
	XSL processor.

	* menus/toolbox-menu.xml: added an "Extensions" placeholder.
2004-04-29 12:52:29 +00:00
Michael Natterer 62dcfaecbf app/actions/qmask-actions.c prepared qmask_actions_update() and the qmask
2004-04-21  Michael Natterer  <mitch@gimp.org>

	* app/actions/qmask-actions.c
	* app/actions/qmask-commands.c: prepared qmask_actions_update()
	and the qmask callbacks to be merged into the image ui manager.

	* app/actions/dialogs-actions.c
	* app/actions/edit-actions.c
	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/layers-actions.c
	* app/actions/plug-in-actions.c
	* app/actions/tools-actions.c
	* app/actions/view-actions.c: fixed lots of typos and buglets
	spotted in my first test run.

	* app/gui/menus.c: register the needed action groups with the
	<Image> menu.

	* app/tools/gimp-tools.c
	* app/tools/gimpdodgeburntool.[ch]
	* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.

	* app/widgets/gimpactionfactory.c
	* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
	updated copyright header.

	* menus/image-menu.xml: fixed typos and added the "Filters"
	submenus.
2004-04-21 10:55:45 +00:00
Sven Neumann 5766718d6f libgimpwidgets/Makefile.am libgimpwidgets/gimpwidgets.h
2004-04-20  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
	from GtkListStore, to be used by GimpIntComboBox and also by the
	image and drawable menus.

	* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.

	* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
	removed API that is provided by the parent class.

	* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
	removed API that is provided by the parent class.

	* app/gui/resize-dialog.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c: changed accordingly.
2004-04-20 19:06:37 +00:00
Sven Neumann e2709b97ba avoid unnecessary casts.
2004-04-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.

	* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
	GtkTreeModelFilter to make items invisible. This is a kludge to
	workaround bug #135875.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimphistogrameditor.c: use the new function to hide
	histogram channels that are not available with the current
	drawable.
2004-04-18 22:38:45 +00:00
Sven Neumann 89cf45541a app/widgets/Makefile.am app/widgets/widgets-types.h removed GimpEnumMenu.
2004-04-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.

	* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
	don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.

	* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
	using GimpEnumStore; replaces GimpEnumMenu.

	* app/widgets/gimpenumstore.[ch]: added new function
	gimp_enum_store_lookup_by_value().

	* app/widgets/gimppropwidgets.[ch]: replaced
	gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().

	* app/gui/brush-select.[ch]
	* app/gui/convert-dialog.c
	* app/gui/layers-commands.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
2004-04-18 15:12:42 +00:00
Henrik Brix Andersen 30fb5a7565 resolved conflicting mnemonic. Fixes bug #139868.
2004-04-17 Henrik Brix Andersen <brix@gimp.org>

* app/tools/gimphuesaturationtool.c
(gimp_hue_saturation_tool_dialog): resolved conflicting
mnemonic. Fixes bug #139868.
2004-04-17 02:06:59 +00:00
Sven Neumann ed4e23096b app/tools/gimpcolorpickertool.c don't use gtk_window_present() to raise
2004-04-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
	raise the tool dialog since it also moves the focus away from the
	image window. Fixes the problem described in bug #139349.
2004-04-16 13:50:28 +00:00
Sven Neumann 77ae74798d some code cleanup that I forgot to do when applying the patch.
2004-04-16  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
	when applying the patch.
2004-04-16 13:36:14 +00:00
Michael Natterer 2f2301c905 derive it from GtkFileChooser instead of GtkFileSelection.
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
	instead of GtkFileSelection.

	* app/gui/file-dialog-utils.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimpthumbbox.c: changed accordingly.

	* app/gui/gradients-commands.c
	* app/gui/vectors-commands.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimptexteditor.c
	* libgimpwidgets/gimpfileentry.c: use file choosers instead of
	file selectors.
2004-04-15 16:28:26 +00:00
Sven Neumann 7849638db3 app/tools/gimpcropoptions.[ch] applied a patch from Jordi Gay that allows
2004-04-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.[ch]
	* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
	allows to keep the aspect ratio fixed.
2004-04-15 15:17:36 +00:00
Michael Natterer a30db14bb7 set translate_desc to "Move Layer Mask".
2004-04-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
	translate_desc to "Move Layer Mask".

	* app/tools/gimpeditselectiontool.c: take the undo desc
	from the moved item's class instead of duplicating all
	strings here.
2004-04-15 15:07:30 +00:00
Michael Natterer 18d9161eea Get rid of the "current_context" which was in fact just a bunch of global
2004-04-15  Michael Natterer  <mitch@gimp.org>

	Get rid of the "current_context" which was in fact just a bunch of
	global variables. Instead, pass the needed context all the way
	from the GUI and the PDB to the core. This is a prerequisite for
	macro recording and generally helps separating the various
	subsystems from each other. Work in progress...

	* app/core/gimp.[ch]: removed member "current_context" and
	gimp_[get|set]_current_context().

	* app/core/gimp-edit.[ch]
	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-bucket-fill.[ch]
	* app/core/gimpdrawable-offset.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-crop.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-merge.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage.[ch]
	* app/core/gimpimagefile.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimplayer.[ch]
	* app/core/gimpselection.[ch]
	* app/core/gimptemplate.[ch]
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/pdb/procedural_db.[ch]
	* app/text/gimptext-compat.[ch]
	* app/text/gimptextlayer-transform.[ch]
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
	parameters and use the passed context instead of
	gimp_get_current_context().

	* app/app_procs.c
	* app/batch.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/paint/gimperaser.c
	* app/paint/gimppaintbrush.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-ins.c
	* app/text/gimptextlayer.c
	* app/tools/gimpblendtool.c
	* app/tools/gimpbucketfilltool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpinktool.c
	* app/tools/gimptransformtool.c
	* app/vectors/gimpvectors.c
	* app/gui/convert-dialog.c
	* app/gui/drawable-commands.c
	* app/gui/edit-commands.c
	* app/gui/file-commands.c
	* app/gui/file-new-dialog.c
	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c
	* app/gui/image-commands.c
	* app/gui/layers-commands.c
	* app/gui/offset-dialog.c
	* app/gui/select-commands.c
	* app/gui/vectors-commands.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
	GIMP_CONTEXT(tool_options) or whatever is the right context
	to the changed core functions.

	* tools/pdbgen/app.pl: pass "GimpContext *context" to all
	generated PDB invokers.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/brushes.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb
	* tools/pdbgen/pdb/paint_tools.pdb
	* tools/pdbgen/pdb/palette.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/palettes.pdb
	* tools/pdbgen/pdb/paths.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/patterns.pdb
	* tools/pdbgen/pdb/selection.pdb
	* tools/pdbgen/pdb/text_tool.pdb
	* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
	parameter to the changed core functions.

	* app/pdb/*_cmds.c: regenerated.
2004-04-14 23:37:34 +00:00
Michael Natterer 2e61d12ed4 Moved the calls to floating_sel_relax()/rigor() from various places to two
2004-04-13  Michael Natterer  <mitch@gimp.org>

	Moved the calls to floating_sel_relax()/rigor() from various
	places to two single spots in the core where they are actually
	needed. Fixes bug #138356 (which was caused by the projection
	being triggered in the middle of changing the floating selection's
	size or the size of the drawable it is attached to). This commit
	effectively removes floating selection fiddling from the core's
	public API.

	* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
	function which returns TRUE if there is a floating selection
	attached to the drawable.

	* app/core/gimpdrawable.c (gimp_drawable_translate)
	(gimp_drawable_set_tiles_full): if the drawable *has* a floating
	selection, relax/rigor it before/after modifying the drawable.

	* app/core/gimplayer.c (gimp_layer_translate)
	(gimp_layer_set_tiles): if the layer *is* the floating selection,
	relax/rigor it before/after modifying it.

	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/gui/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* tools/pdbgen/pdb/layer.pdb: removed calls to
	floating_sel_rigor()/relax() all over the place. Also removed
	lots of undo groups which are obsolete now.

	* app/pdb/layer_cmds.c: regenerated.
2004-04-13 13:54:54 +00:00
Sven Neumann 68d9b6013c push an undo group only when it's needed. This resurrects text undo
2004-04-10  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
	group only when it's needed. This resurrects text undo compression
	that broke when bug #137767 got fixed.
2004-04-10 18:11:00 +00:00
Pedro Gimeno f7ce875889 Sanitize rectangle and ellipse selection handling (bug #138237 and bug
2004-04-05  Pedro Gimeno  <pggimeno@wanadoo.es>

	Sanitize rectangle and ellipse selection handling (bug #138237
	and bug #138103):

	* app/tools/gimprectselecttool.h
	* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
	member "moved" indicating whether the cursor was moved after
	the click.
	(gimp_rect_select_tool_coords_to_integer): New function for
	consistent conversion of the rectangle FP coords to pixels.
	(gimp_rect_select_tool_button_press,
	gimp_rect_select_tool_button_release,
	gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
	it instead of fiddling with the FP coordinates. Update "moved"
	and use it to detect whether the selection needs to be cleared.

	* app/tools/gimpellipseselecttool.c
	(gimp_ellipse_select_tool_draw): use the new coords_to_integer
	function.
2004-04-05 08:08:23 +00:00
Michael Natterer acc72b620e added undo type GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
2004-04-01  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
	GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
	GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.

	* app/core/gimpimage-undo-push.[ch]: added new new function
	gimp_image_undo_push_text_layer_modified() which makes
	modifications of the text_layer's "modified" boolean undoable.

	* app/core/gimpdrawable.[ch]: added new virtual function
	GimpDrawable::push_undo() and moved the actual undo pushing into
	the default implementation gimp_drawable_real_push_undo().

	* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
	function. Pushes the text_layer's modified state to the undo stack
	after upchaining and sets modified to TRUE.

	(gimp_text_layer_set_tiles): ditto.

	(gimp_lext_layer_apply_region)
	(gimp_text_layer_replace_region): removed because their default
	implementations already call gimp_drawable_push_undo().

	(gimp_text_layer_swap_pixels): removed because swap_pixels() is
	used by undo only and doesn't need to care about the text_layer's
	modified state.

	(gimp_text_layer_render): don't set modified to FALSE here because
	we can't push an undo step here.

	(gimp_text_layer_set): push the modified state to the undo stack
	and set it to FALSE here. Also push the layer's tiles if the
	layer was modified.

	* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
	to the undo stack and set it to FALSE here, too.

	Fixes bug #137767.
2004-04-01 14:51:58 +00:00
Simon Budig 157af2d30c One really should use braces when mixing additions and multiplication and
2004-03-31  Simon Budig  <simon@gimp.org>

	* app/tools/gimptransformtool.c: One really should use braces
	when mixing additions and multiplication and the operator
	precedence is not the desired one...

	I feel stupid...  :-)
2004-03-31 14:21:36 +00:00
Michael Natterer 13b46f4847 fixed condition which triggers the path tool's undo hack. Fixes bug
2004-03-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
	fixed condition which triggers the path tool's undo hack.  Fixes
	bug #138086. Also g_object_unref() the undo step.

	Removed trailing whitespace.
2004-03-25 12:46:20 +00:00
Manish Singh 87fba73a12 libgimp/gimp.c close the shm_open fd in the POSIX shm case. We were
2004-03-25  Manish Singh  <yosh@gimp.org>

        * libgimp/gimp.c
        * app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
        shm case. We were leaking an fd here.
2004-03-25 09:02:28 +00:00
Sven Neumann c809f21ab5 keep the text editor open as long as the text tool is connected to a text
2004-03-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: keep the text editor open as long as
	the text tool is connected to a text layer. Open the text editor
	when a text layer is activated in the layers dialog.
2004-03-22 15:19:19 +00:00
Sven Neumann 7469b06006 preserve the text tool on image changes. Instead connect to the text
2004-03-22  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: preserve the text tool on image
	changes. Instead connect to the text layer's "notify::modified"
	signal and disconnect from the layer when it is modified.
	Fixes bug #137890.
2004-03-22 14:32:47 +00:00
Sven Neumann 2326e1b979 added gimp_undo_type_to_name() a similar function used to live in
2004-03-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpundo.[ch]: added gimp_undo_type_to_name() a similar
	function used to live in gimpimage-undo.[ch].

	* app/core/gimpitemundo.c (gimp_item_undo_new): allow NULL as name
	and generate it from the undo_type then.

	* app/core/gimpimage-undo.[ch]: added gimp_image_undo_push_undu(),
	new function that allows to push an undo on the image.

	* app/text/Makefile.am
	* app/text/text-types.h
	* app/text/gimptextundo.[ch]: added GimpTextUndo, derived from
	GimpItemUndo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
	use the new code and simply push a text undo here.

	* app/tools/gimptexttool.c: compress text undos by peeking at the
	undo stack. Fixes bug #137766.
2004-03-21 23:14:21 +00:00
Pedro Gimeno 9127a54dec Fixed several off-by-one problems in display:
2004-03-20  Pedro Gimeno  <pggimeno@wanadoo.es>

	Fixed several off-by-one problems in display:

	* app/display/gimpdisplayshell.h (PROJ_ROUND): New macro to apply
	to a float the same rounding method as the one used when rendering.
	(SCALEX, SCALEY): Use PROJ_ROUND instead of truncating.

	* app/display/gimpdisplayshell-transform.c
	(gimp_display_shell_transform_xy): Accept gdouble image coordinates
	even if the returned screen coordinates are integer. Use PROJ_ROUND
	instead of (gint) to apply proper rounding. Fixes bug #137566.

	* app/display/gimpdisplayshell-transform.h
	(gimp_display_shell_transform_xy): changed accordingly.

	* app/display/gimpdisplayshell-draw.c
	* app/tools/gimpdrawtool.c: make sure everywhere that PROJ_ROUND
	is used either directly or through gimp_display_shell_transform_xy,
	instead of using arbitrary rounding methods.
2004-03-20 21:59:41 +00:00
Sven Neumann 584b3ceb9b don't take the image from tool->gdisp, this might be a NULL pointer.
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_create_vectors): don't
	take the image from tool->gdisp, this might be a NULL pointer.

	* app/core/gimpimage-undo-push.c: removed debugging output.
2004-03-20 20:10:05 +00:00
Sven Neumann 20d03407fe avoid to set the unit property with every size change; only set it if it
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_callback):
	avoid to set the unit property with every size change; only set it
	if it actually changed.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
	allow to pass a GParamSpec that identifies a single text property
	to be changed. In this case, don't store a GimpText object on the
	undo stack but only the changed value.

	* app/tools/gimptexttool.c: use the new undo feature to reduce the
	memory footprint of text undo for the common case.

	* app/text/gimptextlayer.c: changed accordingly.
2004-03-20 17:21:48 +00:00
Simon Budig a08efc86bd Assigned "b" as the default shortcut for the path tool ("Bezier").
2004-03-20  Simon Budig  <simon@gimp.org>

	* app/tools/gimpvectortool.c: Assigned "b" as the default shortcut
	for the path tool ("Bezier").

	Fixes bug #137753.
2004-03-20 15:28:28 +00:00
Sven Neumann fc3846e422 update the text editor when the text changes (for example when undoing
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c: update the text editor when the text
	changes (for example when undoing text changes). Push a drawable
	undo when applying text changes to a modified text layer.
2004-03-20 13:26:02 +00:00
Simon Budig 5e47b5a0ed Make it possible to refresh the preview of an undo step.
2004-03-20  Simon Budig  <simon@gimp.org>

	* app/core/gimpundo.[ch]: Make it possible to refresh the preview
	of an undo step.

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: refresh the preview when
	compressing undos. This ensures that the last preview in the undo
	history always reflects the current state of the image.
2004-03-19 23:42:42 +00:00
Sven Neumann cbbe4f3871 don't exchange the text_layer's text object but sync it with the text
2004-03-20  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-undo-push.c (undo_pop_text_layer): don't
	exchange the text_layer's text object but sync it with the text
	object from the undo step.

	* app/text/gimptextlayer.c (gimp_text_layer_set): in case the
	layer has a mask, push an undo group around the text modifications.

	* app/tools/gimptexttool.c (gimp_text_tool_idle_apply): push a
	text layer undo before applying the text changes.
2004-03-19 23:08:24 +00:00
Sven Neumann 5420154a66 if there's a layer mask, resize it with the layer.
2004-03-19  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.c (gimp_text_layer_render): if there's a
	layer mask, resize it with the layer.

	* app/tools/gimptexttool.c: don't change text_tool->layer before
	calling gimp_text_tool_connect().
2004-03-19 19:26:18 +00:00
Sven Neumann e9e3e22dae added a confirmation dialog that is shown when the user attempts to modify
2004-03-19  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: added a confirmation dialog that is
	shown when the user attempts to modify a modified text layer.
2004-03-19 16:29:36 +00:00
Michael Natterer fddb9ce0e3 app/gui/color-notebook.c (color_notebook_new) app/tools/gimpcroptool.c
2004-03-19  Michael Natterer  <mitch@gimp.org>

	* app/gui/color-notebook.c (color_notebook_new)
	* app/tools/gimpcroptool.c (crop_info_create)
	* app/tools/gimptransformtool.c (gimp_transform_tool_dialog):
	explicitely set a default response for dialog buttons which were
	created using gtk_dialog_add_buttons().
2004-03-19 10:15:56 +00:00
Sven Neumann d7dbf81ab0 cleaned up text tool logic.
2004-03-18  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: cleaned up text tool logic.
2004-03-18 20:55:00 +00:00
Sven Neumann 17679a610b added a missing call to gimp_image_flush().
2004-03-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_bucket_fill):
	added a missing call to gimp_image_flush().

	* app/tools/gimptexttool.c: propagate text changes to the tool
	options.

	* app/text/gimptextlayer.c: made "text", "auto-rename" and
	"modified" properties of the text layer and copy them when
	duplicating a text layer.

	* app/text/gimptextlayer-xcf.[ch]: added utility functions to
	convert the new properties to flags to be saved in the XCF file.

	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c: load and save text layer properties.
	Disabled warnings about unknown properties for stable branches.
2004-03-18 15:27:23 +00:00
Sven Neumann b7965325e6 look ahead in the queue of pending changes and compress changes to the
2004-03-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_apply): look ahead in
	the queue of pending changes and compress changes to the same
	property. Fixed a couple of smaller issues.

	* app/widgets/gimpwidgets-utils.c: corrected indentation.
2004-03-16 00:16:52 +00:00
Michael Natterer 59b77c35c2 emit "update" signals from the drawable before and after setting tiles and
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.c (gimp_drawable_set_tiles_full): emit
	"update" signals from the drawable before and after setting tiles
	and offsets.

	* app/core/gimpdrawable-offset.c (gimp_drawable_offset)
	* app/core/gimpdrawable-transform.c (gimp_drawable_transform_paste)
	* app/core/gimpimage-undo-push.c (undo_pop_layer_mod, _channel_mod)
	* app/text/gimptextlayer.c (gimp_text_layer_render)
	* app/tools/gimptransformtool.c (gimp_transform_tool_doit):
	removed calls to gimp_drawable_update().

	* app/core/gimpdrawable-offset.c (gimp_drawable_offset): don't
	push an undo step before calling gimp_drawable_set_tiles()
	but simply pass push_undo == TRUE and the undo_desc.
2004-03-15 20:05:31 +00:00
Michael Natterer 1ef5fa93ca added "offset_x" and "offset_y" parameters to GimpDrawable::set_tiles().
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable.[ch]: added "offset_x" and "offset_y"
	parameters to GimpDrawable::set_tiles().

	(gimp_drawable_set_tiles): removed the "GimpImageType" parameter.

	(gimp_drawable_set_tiles_full): new function adding type, offset_x
	and offset_y parameters.

	(gimp_drawable_real_set_tiles): set the drawable's offsets from
	the offset parameters and its size from the passed TileManager's
	size. Emit "size_changed" accordingly.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable-offset.c
	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimplayer.c
	* app/text/gimptextlayer.c
	* app/tools/gimptransformtool.c: changed accordingly: removed
	calls to gimp_viewable_size_changed() and all sorts of hackish
	assignments of the drawable's width/height/offset_x/offset_y
	properties.
2004-03-15 19:34:35 +00:00
Michael Natterer 7977603648 don't call gimp_image_flush().
2004-03-15  Michael Natterer  <mitch@gimp.org>

	* app/text/gimptextlayer.c (gimp_text_layer_render): don't call
	gimp_image_flush().

	* app/tools/gimpxttool.c (gimp_text_tool_apply): call it here
	instead.

	Now that we have a common place that exchanges drawable->tiles,
	we can abstract away boundary invalidation for this operation:

	* app/core/gimpdrawable.c (gimp_drawable_real_set_tiles):
	call gimp_drawable_invalidate_boundary() before setting
	the new tiles.

	* app/core/gimpchannel.c (gimp_channel_set_tiles)
	* app/core/gimpdrawable-transform.c (gimp_drawable_transform_paste)
	* app/core/gimpimage-undo-push.c (undo_pop_layer_mod)
	* app/core/gimplayer.c (gimp_layer_scale) (gimp_layer_resize)
	(gimp_layer_flip) (gimp_layer_rotate) (gimp_layer_transform)
	* app/text/gimptextlayer.c (gimp_text_layer_render): removed
	calls to gimp_drawable_invalidate_boundary() from all functions
	which finally call gimp_drawable_real_set_tiles().

	* app/tools/gimptransformtool.c (gimp_transform_tool_doit): no
	need to set channel->bounds_known to FALSE, because
	gimp_drawable_set_tiles() already did this.
2004-03-15 17:53:55 +00:00
Sven Neumann 63bb032f70 app/tools/gimpcolorpickertool.c app/tools/gimpcroptool.c
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimptransformtool.c: don't set tool dialogs transient
	to the image window. Fixes bug #128833.
2004-03-14 22:16:12 +00:00
Sven Neumann f67c16ec60 removed all idle handling here. Changes to the text-layer's text object
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/text/gimptextlayer.[ch]: removed all idle handling here.
	Changes to the text-layer's text object all applied synchronously.

	* app/display/gimpdisplayshell-dnd.c
	* app/text/gimptextlayer-transform.c: removed now obsolete calls
	to gimp_text_layer_flush().

	* app/tools/gimptexttool.[ch]: queue up changes to the proxy text
	object and apply them in one go from a low-priority idle handler.
	This is basically what GimpTextLayer used to do.
2004-03-14 18:48:00 +00:00
Sven Neumann 0993486a0a app/tools/gimptextoptions.[ch] introduced a proxy GimpText object that is
2004-03-14  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]
	* app/tools/gimptexttool.[ch]: introduced a proxy GimpText object
	that is tied to the GimpTextOptions for the lifetime of the text
	tool. Brings us one step closer to text undo...
2004-03-14 17:54:23 +00:00
Michael Natterer 2498c6659e Completed the fix for bug #136702:
2004-03-13  Michael Natterer  <mitch@gimp.org>

	Completed the fix for bug #136702:

	* app/core/gimpitem.[ch]: added "gboolean supersample" and
	"gint recursion_level" to GimpItem::transform().

	* app/core/gimpitem-linked.[ch]	(gimp_item_linked_transform): ditto.

	* app/core/gimpdrawable-transform.[ch]: added "recursion_level"
	parameters and removed the RECURSION_LEVEL #define.

	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/vectors/gimpvectors.c: changed accordingly.

	* app/tools/gimptransformoptions.[ch]: added new property
	"recursion_level" which is not serializable and has no GUI. Pretty
	useless, but it's IMHO better to hardcode the default value here
	than in gimpdrawable-transform.c

	* app/tools/gimptransformtool.c: changed accordingly.

	* tools/pdbgen/pdb/transform_tools.pdb: hardcode "recursion_level"
	to 3.

	* app/pdb/transform_tools_cmds.c: regenerated.
2004-03-13 17:45:58 +00:00
Sven Neumann 27fc81be2a override the "gradient_repeat" property inherited from GimpPaintOptions
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c: override the "gradient_repeat"
	property inherited from GimpPaintOptions and set the default to
	GIMP_REPEAT_NONE. Seems more appropriate for the blend tool.
2004-03-13 15:48:32 +00:00
Sven Neumann c179f9acaf added new virtual function GimpDrawable::set_tiles().
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable.[ch]: added new virtual function
	GimpDrawable::set_tiles().

	* app/core/gimpchannel.c
	* app/core/gimplayer.c: push an undo before chaining up in
	set_tiles().

	* app/core/gimpdrawable-transform.c
	* app/core/gimpimage-convert.c
	* app/tools/gimptransformtool.c: use gimp_drawable_set_tiles()
	instead of fiddling with the drawable's tile manager directly.
2004-03-13 13:56:09 +00:00
Sven Neumann beaed82ce8 for consistency, changed the label from "Supersample" to "Supersampling".
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c (gimp_transform_options_gui): for
	consistency, changed the label from "Supersample" to "Supersampling".
2004-03-13 11:41:57 +00:00
Raphael Quinet 59dfdac9b1 added new "supersample" property to GimpTransformOptions and added
2004-03-13  Raphael Quinet  <quinet@gamers.org>

	* app/tools/gimptransformoptions.[ch]: added new "supersample"
	property to GimpTransformOptions and added corresponding check
	button in the option dialog for the transform tools.

	* app/core/gimpdrawable-transform.[ch],
	* app/core/gimpdrawable.c,
	* app/tools/gimptransformtool.c: new "gboolean supersample"
	parameter added to gimp_drawable_transform_tiles_affine() and
	gimp_drawable_transform_affine().

	* tools/pdbgen/pdb/transform_tools.pdb: ditto.  For the PDB calls,
	the supersample parameter is set to FALSE for "rotate" and "shear"
	and set to TRUE for "perspective", "scale" and "transform_2d".

	* app/pdb/transform_tools_cmds.c: regenerated.

	The new "supersample" option lets the user decide if the
	transformations should use supersampling (RECURSION_LEVEL 3) or
	not.  This fixes both bug #136702 and bug #109817.  Hopefully for
	good, this time.
2004-03-13 11:24:25 +00:00
Raphael Quinet 40825ad048 added missing semicolon that was breaking the build.
2004-03-13  Raphael Quinet  <quinet@gamers.org>

	* app/tools/gimptexttool.c (gimp_text_tool_set_layer): added
	missing semicolon that was breaking the build.
2004-03-13 09:04:37 +00:00
Sven Neumann 4634ee2244 bugfix.
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_set_layer): bugfix.
2004-03-13 03:57:01 +00:00
Sven Neumann 285b58de41 use a GimpSizeEntry for the font size.
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]: use a GimpSizeEntry for the
	font size.

	* app/tools/gimptexttool.c: set the size entry's resolution to the
	image resolution. Fixes bug #118356.
2004-03-13 03:19:53 +00:00
Sven Neumann 07a92fe591 keep a pointer on the active text layer and let the tool follow the active
2004-03-13  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.[ch]: keep a pointer on the active text
	layer and let the tool follow the active layer. Fixes bug #124970.

	* app/gui/layers-commands.c: changed accordingly.
2004-03-13 00:47:31 +00:00
Sven Neumann dc652db2f5 app/tools/gimpcurvestool.c app/tools/gimpinktool.c print debug output to
2004-03-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimpinktool.c
	* app/tools/gimptool.c: print debug output to stderr.
2004-03-12 13:50:36 +00:00
Sven Neumann 8827ea203a always connect the "text_changed" signal so text layers can be edited
2004-03-12  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptexttool.c (gimp_text_tool_editor): always connect
	the "text_changed" signal so text layers can be edited again.
2004-03-12 00:36:17 +00:00
Sven Neumann 97d533410d set the color of the new text from the context foreground color.
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.c (gimp_text_options_create_text):
	set the color of the new text from the context foreground color.
2004-03-11 21:05:36 +00:00
Sven Neumann fb2d9928a8 redid the color handling. Still not perfect, but it is somewhat cleaner.
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptextoptions.[ch]: redid the color handling.
	Still not perfect, but it is somewhat cleaner.
2004-03-11 20:52:49 +00:00
Sven Neumann 21f26743c1 made gimp_config_sync() and gimp_config_connect() also work on objects of
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-utils.c: made gimp_config_sync() and
	gimp_config_connect() also work on objects of different types.
	Properties with the same name and the same type are synced /
	connected.

	* app/core/gimpcontext.[ch]: added convenience functions to get/set
	the font by name.

	* app/tools/gimptextoptions.[ch]: don't hold a GimpText object
	that duplicates properties like font and color which are in
	GimpContext already. Instead added all text properties that are
	controlled from the text tool options.  Handling of the foreground
	color is somewhat broken and needs a GimpContext wizard (Mitch!).

	* app/text/gimptext.c: blurbs are not any longer needed now that
	the property widgets are created from the GimpTextOptions.

	* app/tools/gimptexttool.c: changed accordingly.

	* app/widgets/gimptexteditor.[ch]: use an internal GtkTextBuffer
	and emit "text-changed" when it changes.
2004-03-11 18:47:37 +00:00
Sven Neumann 9ff5123e63 connect notify::preview using g_signal_connect_object(). Fixes bug
2004-03-11  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_initialize):
	connect notify::preview using g_signal_connect_object().
	Fixes bug #136850.
2004-03-11 12:36:10 +00:00
Simon Budig 70671753ae app/base/cpu-accel.c app/display/gimpdisplayshell-dnd.c
2004-03-10  Simon Budig  <simon@gimp.org>

	* app/base/cpu-accel.c
	* app/display/gimpdisplayshell-dnd.c
	* app/tools/gimpvectortool.c
	* app/vectors/gimpbezierstroke.c
	* app/vectors/gimpvectors-import.c: Removed, disabled or
	conditionalized some debug output.

	There still is debug output when pushing/popping the move tool
	via space bar. Mitch wanted to look at that.
2004-03-10 15:10:34 +00:00
Michael Natterer 79e13a1ca0 app/tools/gimpdrawtool.c app/tools/gimpselectiontool.c
2004-03-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpdrawtool.c
	* app/tools/gimpselectiontool.c
	* app/tools/gimptool.c
	* app/tools/gimptransformtool.c: minor cleanup.
2004-03-10 12:45:11 +00:00
Michael Natterer 860f3d46be don't reinitialize the tool when the image becomes dirty but just cancel
2004-03-10  Michael Natterer  <mitch@gimp.org>

	* app/tools/tool_manager.c (tool_manager_image_dirty): don't
	reinitialize the tool when the image becomes dirty but just cancel
	it (fixes bug #131965). Also, only cancel the tool if the tool is
	operating on one of the dirtied image's displays (fixes bug #12253).
2004-03-10 12:25:15 +00:00
Michael Natterer c5efb31dec redid my last layer_mask vs. layer move fix by reordering the whole
2004-03-09  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): redid my
	last layer_mask vs. layer move fix by reordering the whole
	function: now we first check if we can pick a path, guide or layer
	and bail out early if we can't; do the actual init_edit_selection()
	calls in a trivial unconditional switch() after that picking
	check. Removes code duplication and makes the whole function less
	nested and weird.

	Cleaned up the whole file a bit.
2004-03-09 13:24:15 +00:00
Hans Breuer 2036638f73 updated
2004-03-07  Hans Breuer  <hans@breuer.org>

	* themes/Default/images/makefile.msc
	  app/*/makefile.msc plug-ins/makefile.msc : updated
2004-03-07 23:13:51 +00:00
Sven Neumann dd4a8fff00 compute the slider positions in the expose event handler so that the
2004-03-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimplevelstool.c: compute the slider positions in the
	expose event handler so that the sliders get positioned correctly
	when the dialog is resized.
2004-03-05 14:22:02 +00:00
Michael Natterer c9a1455e54 #include "widgets/gimppropwidgets.h"
2004-03-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpcurvestool.c: #include "widgets/gimppropwidgets.h"
2004-03-05 10:03:07 +00:00
Sven Neumann 0ef0afea3a app/tools/gimpcurvestool.c app/tools/gimplevelstool.c added buttons to
2004-03-05  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c: added buttons to toggle the
	histogram scale from the tool dialogs. Fixes bug #136227.
2004-03-05 01:31:33 +00:00
Michael Natterer f3df250a74 if we pick a layer to move and this layer has a mask which is being edited
2004-03-04  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmovetool.c (gimp_move_tool_button_press): if we
	pick a layer to move and this layer has a mask which is being
	edited (active), start moving the mask, not the layer.
2004-03-04 21:01:26 +00:00
Sven Neumann e21dc0ee93 marked new strings for translation.
2004-03-04  Sven Neumann  <sven@gimp.org>

	* app/config/gimprc-blurbs.h: marked new strings for translation.

	* libgimpwidgets/gimpstock.h: added #defines for missing icons.
	This allows us to replace them later without changing the API.

	* app/gui/dialogs-constructors.c
	* app/gui/dialogs-menu.c
	* app/gui/gradient-editor-commands.c
	* app/gui/image-menu.c
	* app/gui/toolbox-menu.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimppaletteeditor.c: use the new stock icon names
	instead of abusing GTK+ and GIMP tool stock icons.

	* app/gui/preferences-dialog.c (prefs_dialog_new): added icons
	to the new check buttons.
2004-03-04 16:10:57 +00:00
Michael Natterer ba265516a1 app/config/gimpcoreconfig.[ch] added boolean properties "global-brush",
2004-03-04  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpcoreconfig.[ch]
	* app/config/gimprc-blurbs.h: added boolean properties
	"global-brush", "global-pattern" etc.

	* app/gui/preferences-dialog.c: added GUI for them to the
	"Tool Options" page.

	* app/tools/tool_manager.c (tool_manager_tool_changed): honor the
	new prefs options when copying the new tool's properties.
	Fixed bug #122519.
2004-03-04 14:04:22 +00:00
Michael Natterer dade4a8430 app/tools/gimpeditselectiontool.c compress undo steps only if the redo
2004-03-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimplayertreeview.c: compress undo steps only
	if the redo stack is empty.
2004-03-02 14:33:31 +00:00
Sven Neumann ad26c89bbb changed the upper limit for the supersampling depth from 10 to 6 (as a
2004-02-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpblendoptions.c: changed the upper limit for the
	supersampling depth from 10 to 6 (as a workaround for bug #133266).
2004-02-29 15:02:04 +00:00
Michael Natterer 4ae2c548d6 cleanup.
2004-02-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c: cleanup.

	* app/tools/gimplevelstool.c (gimp_levels_tool_dialog): added 2px
	spacing between the pick buttons and their entries.
2004-02-25 15:56:50 +00:00
Michael Natterer 0d3e3625c3 moved "shell_desc" from GimpImageMapTool to GimpImageMapToolClass and
2004-02-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.[ch]: moved "shell_desc" from
	GimpImageMapTool to GimpImageMapToolClass and added
	"load_dialog_title" and "save_dialog_title". Create the
	load/save buttons in gimp_image_map_tool_initialize() and
	remember them in the GimpImageMapTool struct. Moved the
	whole load/save button/dialog logic into private functions.

	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c: changed accordingly, removed
	load/save callbacks, inlined the load/save functions into
	GimpImageMapTool's virtual function implementations.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpposterizetool.c
	* app/tools/gimpthresholdtool.c: changed accordingly.
2004-02-25 13:55:45 +00:00
Sven Neumann 0a309fe940 app/tools/gimpcurvestool.[ch] removed obsoleted variables.
2004-02-25  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimplevelstool.h: removed obsoleted variables.
2004-02-25 12:31:18 +00:00
Sven Neumann c66053676c removed obsolete includes 2004-02-25 10:28:09 +00:00
Sven Neumann c1de6345a7 app/tools/gimpcurvestool.[ch] app/tools/gimpimagemapoptions.[ch]
2004-02-25  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcurvestool.[ch]
	* app/tools/gimpimagemapoptions.[ch]
	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimplevelstool.[ch]: moved the settings file dialog
	that was duplicated in the curves and levels tools to the
	GimpImageMapTool class. Store the last used filename in the
	GimpImageMapOptions (proper fix for bug #135059).
2004-02-25 10:23:43 +00:00
Dave Neary 879e24fec9 Revert to 1.2 behaviour of hiding rather than destroying the curves
2004-02-24  Dave Neary  <bolsh@gimp.org>

        * app/tools/gimpcurvestool.c: Revert to 1.2 behaviour of hiding
        rather than destroying the curves load/save dialog. This makes
        the last selected curve be selected when the dialog is
        re-opened, and fixes bug #135059.

        Also append G_DIR_SEPARATOR_S to the end of the filename we
        build while creating the dialog, rather than ".".
2004-02-24 22:09:28 +00:00
Simon Budig 00c35dad74 don't access the array before checking if the index is within the valid
2004-02-23  Simon Budig  <simon@gimp.org>

	* app/tools/gimpinktool-blob.c: don't access the array before
	checking if the index is within the valid bounds...
2004-02-23 20:12:35 +00:00
Sven Neumann 5077aa4c85 Let all GimpImageMap tools remember the state of the preview toggle (bug
2004-02-22  Sven Neumann  <sven@gimp.org>

	Let all GimpImageMap tools remember the state of the preview toggle
	(bug #135059):

	* app/tools/Makefile.am
	* app/tools/gimpimagemapoptions.[ch]
	* app/tools/tools-types.h: added new GimpToolOptions class to hold
	the preview setting.

	* app/tools/gimpbrightnesscontrasttool.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.[ch]
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpimagemaptool.[ch]
	* app/tools/gimpposterizetool.c
	* app/tools/tools-types.h: use the new class.
2004-02-22 14:28:53 +00:00