Commit Graph

9172 Commits

Author SHA1 Message Date
David Odin d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
Manish Singh b6d3a912fd Guard against bogus logical screen dimensions. Fixes bug #151053.
2004-08-25  Manish Singh  <yosh@gimp.org>

        * plug-ins/common/gifload.c: Guard against bogus logical screen
        dimensions. Fixes bug #151053.
2004-08-25 22:32:54 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann 8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
William Skaggs c92a38626b Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
2004-08-25 18:26:06 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin 54fa5a0af9 eradicate some more previews in favor of views.
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
  in favor of views.
2004-08-25 17:54:12 +00:00
William Skaggs 856b87b105 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/Makefile.am: added ggr.txt to list.
2004-08-25 17:50:35 +00:00
William Skaggs 21ba16c67d Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: added new file decribing the ggr
	(Gimp gradient) file format.
2004-08-25 17:41:34 +00:00
David Odin f168881c18 app/display/gimpnavigationview.c renamed these files to...
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...

* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
  changed GimpNavigationView to GimpNavigationEditor since it is really
  inherited from GimpEditor anyway.

This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.

* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 16:02:10 +00:00
Michael Natterer da34232a04 print bad '%' sequences literally instead of warning (g_warning() is for
2004-08-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): print bad '%' sequences
	literally instead of warning (g_warning() is for programming
	errors only and must never be triggered by bad or intermediate
	user input). Fixes bug #150676
2004-08-25 14:38:49 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Sven Neumann 6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann 509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
David Odin f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann 0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Simon Budig e86dff66da Implemented the ellipse basic shape differently to avoid possible rounding
2004-08-22  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
	shape differently to avoid possible rounding issues with
	the _arcto () command.

	* app/vectors/gimpvectors-import.c: properly close the rounded
	rectangles.
2004-08-22 12:31:47 +00:00
Sven Neumann d6a016b4b4 support optional center coordinates for the "rotate" transformations.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c (parse_svg_transform): support
	optional center coordinates for the "rotate" transformations.
	(parse_svg_transform): apply transformations in reverse order. The
	SVG spec is rather confusing here.
2004-08-22 10:50:22 +00:00
Sven Neumann 59e521c64f fixed a bug I introduced with my last commit.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
	a bug I introduced with my last commit.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
2004-08-21 15:47:31 +00:00
Sven Neumann 6f3c1ae503 added new function gimp_bezier_stroke_new_ellipse() that provides a simple
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.[ch]: added new function
	gimp_bezier_stroke_new_ellipse() that provides a simple API to
	create a bezier stroke that represents an ellipse.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "circle" and "ellipse".
2004-08-21 13:50:19 +00:00
Simon Budig 5dd10c748d Fix some GUI issues. Make the relation between the dimension parameter and
2004-08-21  Simon Budig  <simon@gimp.org>

	* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
	between the dimension parameter and the rank thingies more clear
	also changed to a nicer layout.
2004-08-21 10:38:38 +00:00
Sven Neumann e63c6511fd added support for the basic SVG shapes "polyline" and "polygon".
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "polyline" and "polygon".
2004-08-21 09:41:12 +00:00
Sven Neumann 905fcfd6b5 added support for importing the basic SVG shape "line". Other shapes will
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for importing
	the basic SVG shape "line". Other shapes will follow...
2004-08-21 08:03:39 +00:00
Sven Neumann c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
Sven Neumann f5045bdcdb declare local function as static.
2004-08-20  Sven Neumann  <sven@gimp.org>

	* modules/controller_linux_input.c: declare local function as static.
2004-08-20 20:58:12 +00:00
Michael Schumacher 38153309eb modified the coordinate insertion into the file name to leave the file
2004-08-19  Michael Schumacher <schumaml@cvs.gnome.org>

	* plug-ins/common/guillotine.c: modified the coordinate insertion
	into the file name to leave the file extension intact, changed the
	format of the coordinates. Fixes bug #101901.
2004-08-19 14:26:24 +00:00
Manish Singh 83a94230ed app/widgets/gimpcellrendereraccel.c app/widgets/gimphistogrambox.c Get rid
2004-08-18  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimphistogrambox.c
        * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-19 00:21:55 +00:00
Sven Neumann 0620ee069e no need to set a size_request here.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/gui/color-notebook.c: no need to set a size_request here.

	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

	* libgimpwidgets/gimpcolorscales.c
	* modules/colorsel_cmyk.c: don't set a minimum width on the color
	scales. Improves behaviour for narrow color dockables.
2004-08-18 21:50:26 +00:00
Sven Neumann d5cd7ae3f1 fixed crashes that occured with small sizes, some code cleanups and a
2004-08-18  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_triangle.c: fixed crashes that occured with
	small sizes, some code cleanups and a simple optimization.
2004-08-18 18:09:06 +00:00
Sven Neumann 2d5ee4485d define GIMP_HELP_DOCK_SEPARATOR.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: help-ids are never used directly,
	use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-18 09:53:38 +00:00
Simon Budig f960771bd3 Made the triangle colorselector resizeable. Removed minimum size request
2004-08-17  Simon Budig  <simon@gimp.org>

	* modules/colorsel_triangle.c: Made the triangle colorselector
	resizeable. Removed minimum size request (would probably need some
	testing for *very* small sizes though).
2004-08-17 20:21:11 +00:00
William Skaggs 8e36dd8ffb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 17:46:48 +00:00
Sven Neumann 7755461070 reset the "cancel" signal handler id when a new progress is set.
2004-08-17  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
	the "cancel" signal handler id when a new progress is set.
2004-08-17 15:16:44 +00:00
Sven Neumann 7b1cc4ae0c minor cleanups.
2004-08-17  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_cmyk.c: minor cleanups.

	* modules/colorsel_water.c: let the widget take the available
	space, don't set a minimum size.
2004-08-17 15:07:27 +00:00
Sven Neumann ed2116ac89 app/plug-in/plug-in-progress.c app/plug-in/plug-in-run.c don't keep a
2004-08-17  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c: don't keep a strong reference to the
	GimpProgress object, instead use a weak reference and deal with
	the progress being destroyed while the plug-in is running.
	Fixes bug #150194.
2004-08-17 08:21:30 +00:00
Sven Neumann 6543cfde20 fixed labels in CMYK mode. Fixes bug #150213.
2004-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
	labels in CMYK mode. Fixes bug #150213.
2004-08-16 07:24:42 +00:00
David Odin 1c39d63714 fixed a typo preventing the preview to be redrawn correctly in some case.
* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
  redrawn correctly in some case. Reported by AndyFitz.
2004-08-16 01:30:33 +00:00
Sven Neumann 1be91fc24b minor cleanups.
2004-08-15  Sven Neumann  <sven@gimp.org>

	* modules/colorsel_triangle.c: minor cleanups.

	* modules/colorsel_water.c: GimpPreviewArea seems like overkill
	here, use a GtkDrawingArea instead.
2004-08-15 18:01:11 +00:00
David Odin 7ef3447a69 modules/colorsel_triangle.c Replaced the GtkPreviews by GimpPreviewAreas.
* modules/colorsel_triangle.c
* modules/colorsel_water.c: Replaced the GtkPreviews by
  GimpPreviewAreas.
2004-08-15 15:31:20 +00:00
Manish Singh c1d5c94b03 make sure array length values are not negative, to prevent bad calls to
2004-08-14  Manish Singh  <yosh@gimp.org>

        * libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
        length values are not negative, to prevent bad calls to g_new.
        Addresses bug #150154.
2004-08-15 06:52:45 +00:00
Sven Neumann 63355f333b no need to link gimp-help-lookup with any GIMP libraries.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
	any GIMP libraries.
2004-08-14 18:13:41 +00:00
Sven Neumann 1d669a5b4e allow to specify the location of the index files independently from the
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/domain.[ch]: allow to specify the location of the
	index files independently from the base URL.

	* plug-ins/help/help.c: changed accordingly.

	* plug-ins/help/gimp-help-lookup.c: added command-line options to
	specify base URI and root directory for index files.
2004-08-14 17:53:40 +00:00
Sven Neumann dba01430e9 don't mess up the order of languages.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/locales.c (locales_parse): don't mess up the order
	of languages.

	* plug-ins/help/gimp-help-lookup.c: parse command-line options,
	added --help output.
2004-08-14 16:59:16 +00:00
Sven Neumann df6dc99d05 moved some defines to the header file.
2004-08-14  Sven Neumann  <sven@gimp.org>

	* plug-ins/help/help.[ch]: moved some defines to the header file.

	* plug-ins/help/domain.c: trivial change to remove the libgimpbase
	dependency.

	* plug-ins/help/Makefile.am
	* plug-ins/help/gimp-help-lookup.c: added a very simple
	command-line tool that allows to lookup a help-id.
2004-08-14 15:47:22 +00:00
David Odin 21de121062 update the preview when the user choose a different algorithm from the
* plug-ins/common/edge.c: update the preview when the user choose a
  different algorithm from the combo box. This was one of the main
  reasons to have a preview here, after all.
2004-08-12 23:31:15 +00:00
Sven Neumann b8d208a92f forgot to commit ChangeLog changes 2004-08-12 22:30:25 +00:00
Michael Natterer 1437f52d63 make sure that all actions, even if they have no menu proxy, can be
2004-08-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
	make sure that all actions, even if they have no menu proxy, can
	be invoked by their accelerators. Fixes bug #149938.

	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
	removed the same code here.

	* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
	function which disconnects from "accel_changed" of the accel_group
	before upchaining (== before emitting "destroy").

	The above changes make this one redundant, but since the crash in
	bug #149938 was triggered by "accel_changed" emitted in the middle
	of g_object_unref(tree_model), it feels better to be paranoic here
	(fiddling with objects in destruction is no fun).

	(gimp_action_view_accel_edited): don't warn if assigning the same
	accel to the same action again.

	(gimp_action_view_new): don't leak all accel_closures.
2004-08-12 20:04:19 +00:00
David Odin 6b4d16e03b added a preview.
* plug-ins/common/edge.c: added a preview.
2004-08-12 17:14:25 +00:00
Sven Neumann 45d77a3aaa plug-ins/common/sel_gauss.c place the preview widget into the upper left
2004-08-12  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/sel_gauss.c
	* plug-ins/common/unsharp.c: place the preview widget into the
	upper left corner like all other plug-ins do.

	* plug-ins/help/domain.c: added some (disabled) debug output.
2004-08-12 00:01:05 +00:00
David Odin 8f394a5f66 added a preview.
* plug-ins/common/sel_gauss.c: added a preview.

* plug-ins/common/unsharp.c: removed unused variables.
2004-08-11 23:18:31 +00:00
Sven Neumann 9cabd2942f changed the icons to indicate what part of the context is affected by the
2004-08-12  Sven Neumann  <sven@gimp.org>

	* app/actions/context-actions.c: changed the icons to indicate
	what part of the context is affected by the action. Looks better
	in the shortcut editor.
2004-08-11 23:14:02 +00:00
Sven Neumann 34841a6ddd tpyo 2004-08-11 21:46:12 +00:00
Michael Natterer ee3f7c9181 plug-ins/common/cartoon.c plug-ins/common/neon.c
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* plug-ins/common/cartoon.c
	* plug-ins/common/neon.c
	* plug-ins/common/photocopy.c
	* plug-ins/common/softglow.c: added four new plug-ins contributed
	by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.

	* plug-ins/common/plugin-defs.pl: added them here.

	* plug-ins/common/mkgen.pl: removed tab insanity now that
	libgimpoldpreview is gimp.

	* plug-ins/common/.cvsignore
	* plug-ins/common/Makefile.am: regenerated.
2004-08-11 15:25:14 +00:00
David Odin cda017512e Bad DindinX! Don't break the build!
* configure.in
* plug-ins/common/mkgen.pl
* plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from here too.

* plug-ins/common/Makefile.am: regenerated.
2004-08-11 14:53:43 +00:00
David Odin 0efc08e208 Removed the GimpOldPreview stuff. Die, crap, die!
* plug-ins/libgimpoldpreview/*: removed.

* plug-ins/Makefile.am
* plug-ins/common/Makefile.am: changed accordingly.

* plug-ins/common/max_rgb.c
* plug-ins/common/noisify.c
* plug-ins/common/tileit.c: removed last forgotten
  #include "libgimpoldpreview.h".
2004-08-11 14:39:13 +00:00
Michael Natterer a8e599ebbf app/widgets/gimpcontainercombobox.[ch] when removing the last item from
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainertreeview.c: when removing the last item
	from the view, manually clear all GimpCellRendererViewables'
	"renderer" properties; otherwise we have stale GimpPreviewRenderers
	with still-refed viewables hanging around in the cells.
	Works around GTK+ bug #149906.
2004-08-11 14:07:35 +00:00
Michael Natterer db1d6b0d6e app/core/gimp.c converted tabs to spaces, cosmetic changes.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp.c
	* app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
	changes.
2004-08-11 14:00:08 +00:00
David Odin a59c673d03 GimpPreviewArea-ified.
* plug-ins/common/waves.c: GimpPreviewArea-ified.
2004-08-11 13:37:40 +00:00
Michael Natterer d03577fab2 Restored sane sorting order for menus which are created entirely by
2004-08-11  Michael Natterer  <mitch@gimp.org>

	Restored sane sorting order for menus which are created
	entirely by plug-ins (like Xtns/Script-Fu/...).

	* app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
	return the built path. For each sub-menu created, add a "Menus"
	placeholder and a separator. Make sure all sub-menus end up in the
	"Menus" placeholder. More readable because we can use the path
	returned by the recursive invocation now.

	(plug_in_menus_add_proc): simplified by using the path
	plug_in_menus_build_path() returns.
2004-08-11 10:45:47 +00:00
Michael Natterer 57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Michael Natterer 49dd42f65b app/plug-in/plug-in-message.c app/plug-in/plug-in-run.c (plug_in_temp_run)
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-run.c (plug_in_temp_run)
	* libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
	#define and all code which was in #ifndef ENABLE_TEMP_RETURN.
2004-08-11 09:41:48 +00:00
Michael Natterer ca30f73817 added "display_ID" to gimp_new_progress().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().

	* app/gui/gui-vtable.c: changed accordingly.

	* app/plug-in/plug-in-progress.[ch]: reenabled showing the
	progress in a particular display.
2004-08-11 09:36:51 +00:00
Michael Natterer 4671054c08 added a commented-out midi controller entry with some example mappings.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* etc/controllerrc: added a commented-out midi controller entry
	with some example mappings.
2004-08-11 09:16:36 +00:00
David Odin d04237e085 converted to GimpPreviewArea.
* plug-ins/common/plasma.c: converted to GimpPreviewArea.
2004-08-11 02:36:40 +00:00
David Odin 8f9e510998 converted to GimpPreviewArea. Also added scrollbars to move around. The
* plug-ins/common/noisify.c: converted to GimpPreviewArea.  Also added
  scrollbars to move around.  The preview was rather useless without them.
2004-08-11 00:59:21 +00:00
Michael Natterer 502f9b71f3 app/core/gimpdrawable-blend.c some progress cleanup.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable-blend.c
	* app/core/gimpprogress.c: some progress cleanup.

	* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
	need to warn if there is already a progress active, just silently
	return NULL as all other GimpProgressInterface implementors.

	* app/plug-in/plug-in-progress.c: several progress fixes.
	It's still a mess.

	* plug-ins/common/url.c: don't show progress depending on
	run_mode. Run the actual file plug-in with the same run_mode we
	were invoked with.
2004-08-11 00:34:34 +00:00
Sven Neumann 846bacd905 app/gui/file-open-location-dialog.c increased horizontal size request to
2004-08-11  Sven Neumann  <sven@gimp.org>

	* app/gui/file-open-location-dialog.c
	* app/widgets/gimpprogressbox.c: increased horizontal size request
	to reduce resizing.
2004-08-10 23:37:06 +00:00
Michael Natterer 828b852e06 fixed annoying resizing when thumbnailing exactly one image.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	fixed annoying resizing when thumbnailing exactly one image.
2004-08-10 22:34:45 +00:00
Michael Natterer 06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer 95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
David Odin 0a4a09a1d4 GimpPreviewArea-ified.
* plug-ins/common/blinds.c: GimpPreviewArea-ified.
2004-08-10 18:00:03 +00:00
David Odin d0de558f68 Ported to GimpPreviewArea, use an enum for the color model instead of some
* plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
  for the color model instead of some defines and use gboolean instead
  of gint where appropriate.
2004-08-10 15:07:50 +00:00
Sven Neumann b6efff7e77 plugged more file descriptor leaks.
2004-08-10  Sven Neumann  <sven@gimp.org>

	* app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
	plugged more file descriptor leaks.
2004-08-10 11:33:13 +00:00
David Odin c1566ea848 don't leak a file descriptor when reading a bad .vbr file.
* app/core/gimpbrushgenerated.c: don't leak a file descriptor when
  reading a bad .vbr file.
2004-08-10 02:37:44 +00:00
Sven Neumann 652cd385a4 don't show progress on the image window while updating the preview.
2004-08-10  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/unsharp.c: don't show progress on the image
	window while updating the preview.
2004-08-09 23:35:40 +00:00
Sven Neumann 1ad58630c8 reset the progress when done; some code cleanup.
2004-08-09  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/unsharp.c (unsharp_region): reset the progress
	when done; some code cleanup.
2004-08-09 21:07:57 +00:00
David Odin a3d5f6408d continuously show the (original) image during a scrollbar movement. This
* plug-ins/common/unsharp.c: continuously show the (original) image
  during a scrollbar movement.  This makes it easier to navigate.
2004-08-09 19:10:31 +00:00
Michael Natterer 88768c66f8 Applied (slightly modified) patch from Shlomi Fish which adds a progress
2004-08-09  Michael Natterer  <mitch@gimp.org>

	Applied (slightly modified) patch from Shlomi Fish which adds a
	progress bar to the RGB -> INDEXED conversion. Fixes bug #145274

	(and shows that we really really need a GimpProgressInterface in
	the core to give progress users full access to the progress API)

	* app/core/gimpimage-convert.[ch]: added special
	GimpImageConvertProgress function typedef to cope with the
	different stages of converting.  Support passing such a callback &
	data to gimp_image_convert() and update the progress accordingly.

	* app/gui/convert-dialog.[ch]: added a convert progress callback
	and pass it to gimp_image_convert().

	* app/actions/image-commands.c
	* tools/pdbgen/pdb/convert.pdb: changed accordingly.

	* app/pdb/convert_cmds.c: regenerated.
2004-08-09 16:08:36 +00:00
Sven Neumann 1a3bbe0e7c added GenericName and Version, updated Categories.
2004-08-09  Sven Neumann  <sven@gimp.org>

	* data/misc/gimp.desktop.in.in: added GenericName and Version,
	updated Categories.
2004-08-09 11:04:42 +00:00
Michael Natterer 8f366beff9 don't dereference gimp->current_plug_in->plug_in_def if it's NULL. Fixes
2004-08-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-ins.c
	(plug_ins_file_register_magic)
	(plug_ins_file_register_mime): don't dereference
	gimp->current_plug_in->plug_in_def if it's NULL.
	Fixes bug #149678.

	(plug_ins_file_register_mime): moved returning the proc_def inside
	the right if() statement.
2004-08-09 10:25:50 +00:00
Hans Breuer eafd79de87 gimp_create_display() with the right parameters order
2004-08-09  Hans Breuer  <hans@breuer.org>

	* app/core/gimp-edit.c(gimp_edit_paste_as_new) :
	gimp_create_display() with the right parameters order

	* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
	handle gtk_style_lookup_icon_set() returnig NULL

	* app/gimpcore.def app/widgets/makefile.msc
	  themes/default/images/makefile.msc : updated
2004-08-08 22:47:23 +00:00
Sven Neumann 608e16e5d8 use the basename as Title, not the full filename. Fixes bug #149669.
2004-08-09  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/postscript.c (save_ps_header): use the basename
	as Title, not the full filename. Fixes bug #149669.
2004-08-08 22:26:17 +00:00
Sven Neumann 4bae8fe66b when printing a character array, don't flush the buffer for each byte but
2004-08-08  Sven Neumann  <sven@gimp.org>

	* plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
	character array, don't flush the buffer for each byte but wait
	until it is filled.
2004-08-08 19:15:06 +00:00
Sven Neumann bf3347161d use g_strdup_vprintf() instead of guessing the string length. Also declare
2004-08-08  Sven Neumann  <sven@gimp.org>

	* plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
	g_strdup_vprintf() instead of guessing the string length. Also
	declare the function using G_GNUC_PRINTF().
2004-08-08 18:44:31 +00:00
William Skaggs 79d50e2adc Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/ifscompose/README.ifscompose: fix out of date info,
	pointed out by the author.
2004-08-08 18:17:53 +00:00
Sven Neumann dbd5eb769b do not build test-preview-area by default, put it into EXTRA_PROGRAMS.
2004-08-08  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/Makefile.am: do not build test-preview-area by
	default, put it into EXTRA_PROGRAMS. Fixes parallel builds.
2004-08-08 11:55:34 +00:00
Michael Natterer ea8198e401 new function which checks a GimpImageType against the
2004-08-08  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
	new function which checks a GimpImageType against the
	proc_def->image_types_val mask.

	* app/actions/plug-in-actions.c: use the new function here. Also
	separated setting the "Repeat last" and "Reshow last" actions'
	labels from setting their sensitivity and made them use the same
	sensitivity logic as all other plug-in actions. Fixes bug #149567.
2004-08-08 10:53:19 +00:00
Simon Budig 084f814e1b emit the COLOR_CHANGED signal when the hex entry is changed.
2004-08-07  Simon Budig  <simon@gimp.org>

	* libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
	when the hex entry is changed.
2004-08-07 18:53:32 +00:00
Sven Neumann d1d7cb4c0d abort if the configured filename encoding can't be converted to UTF-8.
2004-08-07  Sven Neumann  <sven@gimp.org>

	* app/sanity.c: abort if the configured filename encoding can't be
	converted to UTF-8. Fixes bug #149464 for the HEAD branch.
2004-08-07 18:37:31 +00:00
Sven Neumann 5ebbc4d68f corrected dither offset.
2004-08-07  Sven Neumann  <sven@gimp.org>

	* libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
	corrected dither offset.
2004-08-07 15:56:13 +00:00
David Odin 4b7c4edbd4 use a GimpPreviewArea instead of GimpOldPreview.
* plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of GimpOldPreview.
2004-08-07 15:36:12 +00:00
Sven Neumann ad3866b3de use a GtkDrawingArea instead of GtkPreview.
2004-08-07  Sven Neumann  <sven@gimp.org>

	* libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
	GtkPreview.

	* libgimp/gimpbrushmenu.c
	* libgimp/gimppatternmenu.c: minor cleanup.
2004-08-07 14:44:58 +00:00
David Odin 97247b336f ported to GimpPreviewArea, did some cleanup and removed tabs.
* plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
  cleanup and removed tabs.
2004-08-07 13:29:02 +00:00
Sven Neumann b3867f6534 bumped version number to 2.1.4.
2004-08-07  Sven Neumann  <sven@gimp.org>

	* configure.in:  bumped version number to 2.1.4.
2004-08-07 09:07:02 +00:00
David Odin f5454dd1c1 ported to GimpPreviewArea.
* plug-ins/common/illusion.c: ported to GimpPreviewArea.
2004-08-07 00:49:05 +00:00
David Odin e08e1d746b fixed the rendering for INDEXED and INDEXEDA image types.
* libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
  and INDEXEDA image types.

* plug-ins/common/grid.c: ported to GimpPreviewArea.
2004-08-07 00:04:16 +00:00
David Odin 989d6dc33c ported to GimpPreviewArea.
* plug-ins/common/glasstile.c: ported to GimpPreviewArea.
2004-08-06 20:52:44 +00:00
David Odin 4960753dc4 ported to GimpPreviewArea.
* plug-ins/common/nlfilt.c: ported to GimpPreviewArea.
2004-08-06 19:38:13 +00:00
Michael Natterer da9c039eb2 removed the recently added "gdouble aspect_ratio"...
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.h: removed the recently added
	"gdouble aspect_ratio"...

	* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
2004-08-06 16:39:11 +00:00
Michael Natterer db821565e2 Transform tool cleanup:
2004-08-06  Michael Natterer  <mitch@gimp.org>

	Transform tool cleanup:

	* app/tools/gimptransformtool.[ch]: added new virtual function
	GimpTransformTool::dialog_update().
	Made wrapper for ::recalc() public and function
	transform_bounding_box() private.
	Call ::dialog_update() and transform_bounding_box() from the
	::recalc() wrapper.

	* app/tools/gimpperspectivetool.[ch]
	* app/tools/gimprotatetool.[ch]
	* app/tools/gimpscaletool.[ch]
	* app/tools/gimpsheartool.[ch]: turned all info_dialog update
	functions into GimpTransformTool::dialog_update() implementations
	and don't call them from ::recalc(), also removed calls to
	transform_bounding_box(); both functions are called by the parent
	class now. Call gimp_transform_tool_recalc() when dialog values
	were changed, not the tool's internal function.
	Moved all static variables to the instance structs.
2004-08-06 16:27:13 +00:00
Michael Natterer 42bc755ca7 applied (modified) patch from Ari Pollak which enables controlling the
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
	Pollak which enables controlling the shear direction from the
	dialog and changing the shear direction without hitting "Reset".
	Fixes bug #149467.

	Also moved all static variables to the GimpShearTool struct and
	converted tabs to spaces.
2004-08-06 13:56:34 +00:00
David Odin 91cf50aefb ported to GimpPreviewArea.
* plug-ins/common/nova.c: ported to GimpPreviewArea.
2004-08-06 13:30:49 +00:00
Sven Neumann 3efeb7982a Made 2.1.3 release.
2004-08-06  Sven Neumann  <sven@gimp.org>

        * Made 2.1.3 release.
2004-08-06 01:45:32 +00:00
David Odin e6d4d26c75 ported to GimpPreviewArea (from GimpOldPreview).
* plug-ins/common/polar.c: ported to GimpPreviewArea (from GimpOldPreview).
2004-08-06 01:28:01 +00:00
Sven Neumann e890f8ff83 include <glib-object.h>.
2004-08-06  Sven Neumann  <sven@gimp.org>

	* libgimpcolor/test-color-parser.c: include <glib-object.h>.
2004-08-06 01:04:13 +00:00
Sven Neumann 8651be295e removed unused variables.
2004-08-06  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/depthmerge.c:
	* plug-ins/common/despeckle.c: removed unused variables.
2004-08-06 00:59:58 +00:00
David Odin a560d35e23 ported to GimpPreviewArea (from GimpPreviewArea)
* plug-ins/common/flarefx.c: ported to GimpPreviewArea (from GimpPreviewArea)
2004-08-06 00:36:47 +00:00
Sven Neumann 46960e26d7 forgot to remove tw_sess.c here.
2004-08-06  Sven Neumann  <sven@gimp.org>

	* plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
	tw_sess.c here.
2004-08-06 00:12:40 +00:00
David Odin c3acd71590 ported to GimpPreviewArea (from GimpOldPreview)
* plug-ins/common/wind.c: ported to GimpPreviewArea (from GimpOldPreview)
2004-08-05 16:43:20 +00:00
Michael Natterer bba0394529 increased the handle size from 8 to 9 pixels (which is the same as in the
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpiscissorstool.c: increased the handle size from 8
	to 9 pixels (which is the same as in the path tool) as suggested
	in bug #134250.
2004-08-05 15:44:34 +00:00
Michael Natterer 9dc8302647 make the cursor coordinates label insensitive when displaying out-of-image
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.c: make the cursor coordinates label
	insensitive when displaying out-of-image coordinates.
2004-08-05 14:56:18 +00:00
Michael Natterer db5e7e38bd s/pseudocolor visuals/8-bit (256 colors) displays/. Fixes bug #137078.
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
	s/pseudocolor visuals/8-bit (256 colors) displays/.
	Fixes bug #137078.
2004-08-05 14:15:37 +00:00
Michael Natterer 60fd11d79b Enabled previewing items without selecting them in all list and grid views
2004-08-05  Michael Natterer  <mitch@gimp.org>

	Enabled previewing items without selecting them in all list and
	grid views using mouse button 2. Implicitly enables previewing of
	items in container popups and thus fixes bug #121011:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event)
	* app/widgets/gimpcellrendererviewable.c
	(gimp_cell_renderer_viewable_clicked): show the preview also on
	mouse button 2 click.

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): dispatch mouse button 2
	clicks to GimpCellRendererViewable, but don't select or change
	anything in the tree_view.

	Unrelated cleanup:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
	don't offset bevent->x,y by widget->allocation.x,y before calling
	gimp_preview_popup_show() ...

	* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
	... instead, do it here generically (check if the parent widget is
	GTK_WIDGET_NO_WINDOW()).
2004-08-05 13:43:38 +00:00
Michael Natterer c912a954f3 allocate the empty_iter using g_new0(). Fixes valgrind warnings about
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
	allocate the empty_iter using g_new0(). Fixes valgrind warnings
	about reads from uninitialized memory.
2004-08-05 12:13:02 +00:00
Michael Natterer 38b4ff0535 use GTK_STOCK_JUMP_TO for all "Set" actions (like
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
	all "Set" actions (like context-foreground-red-set).
2004-08-05 11:57:36 +00:00
Michael Natterer 6685ccdc22 fix my typos. 2004-08-05 11:20:36 +00:00
Michael Natterer 8db70a4c79 app/tools/gimpscaletool.c applied patch from Jordi Gay (attached to bug
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpscaletool.c
	* app/tools/gimptransformtool.h: applied patch from Jordi Gay
	(attached to bug #131111) which adds an aspect ratio spinbutton to
	the scale dialog and keeps the aspect ratio intact when with or
	height are changed using the dialog. Fixes bug #132274.

	* app/tools/gimpcroptool.c
	* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
	"wrap" and decrease their climb_rate.
2004-08-05 11:12:58 +00:00
Michael Natterer f3d3a3a6b9 app/actions/context-actions.c app/actions/context-commands.[ch] added
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/context-actions.c
	* app/actions/context-commands.[ch]
	* menus/image-menu.xml.in: added actions, callbacks and menu items
	for the brush shape and spikes.
2004-08-05 10:29:19 +00:00
Simon Budig 53c4d987bc changed the default colors for the first invocation to the current
2004-08-04  Simon Budig  <simon@gimp.org>

	* plug-ins/common/grid.c: changed the default colors for the
	first invocation to the current foregroud color which is more
	likely to be useful than the blue shades.
2004-08-04 18:53:04 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Simon Budig 428c4a8d60 Enhanced the range of the hardness parameter to make more soft brushes
2004-08-04  Simon Budig  <simon@gimp.org>

	* app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
	parameter to make more soft brushes possible. Please note that this
	makes existing generated brushes look more soft. But since people
	apparently rarely use more than one or two generated brushes and
	these get changed frequently I guess it should be OK.
2004-08-04 17:41:33 +00:00
Michael Natterer fd1a0e142c Allow URI drops from apps linked against GLib < 2.4.4 to GIMP linked
2004-08-04  Michael Natterer  <mitch@gimp.org>

	Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
	linked against GLib >= 2.4.5. Fixes bug #148140.

	* app/core/gimp-utils.[ch]: added gimp_check_glib_version().

	* app/widgets/gimpselectiondata.c: added runtime check for GLib
	versions that encode file:// URIs correctly (>= 2.4.5). For older
	(broken) GLibs, leave the code path as is, for newer (fixed) ones,
	perform an additional check if the dropped URI is in the (broken)
	escaped-UTF-8 format and convert it to local filename encoding.

	* app/gui/gui.c: warn the user that non-ASCII filenames can't
	be used when linked against GLib 2.4.4.
2004-08-04 17:11:39 +00:00
Michael Natterer 51b8b94ed9 changed member "ProcRecord last_plug_in" to PlugInProcDef last_plug_in".
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/core/gimp.[ch]: changed member "ProcRecord last_plug_in" to
	PlugInProcDef last_plug_in". Added function
	gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.

	* app/actions/plug-in-commands.c
	* app/plug-in/plug-in-run.c: changed accordingly.

	* app/actions/plug-in-actions.c: factored out updating of the
	"Reshow Last" and "Rerun Last" actions to a private function.
	Connect each "plug-in" action group to Gimp::last-plug-in-changed
	and update the actions' label and sensitivity in the
	callback. Fixes bug #149139.
2004-08-04 14:00:14 +00:00
Michael Natterer 0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
Manish Singh f9409dc88e Really really really really fix WINDRES logic.
2004-08-04  Manish Singh  <yosh@gimp.org>

        * configure.in: Really really really really fix WINDRES logic.
2004-08-04 09:00:34 +00:00
David Odin 14eb27c540 ported to GimpPreviewArea. Still needs work.
* plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs work.
2004-08-03 16:16:19 +00:00
Michael Natterer 8260cd69ce ref/unref the view around the calls to gimp_container_view_item_selected()
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c
	(gimp_container_grid_view_item_context): ref/unref the view around
	the calls to gimp_container_view_item_selected() and _item_context()
	because the former may destroy the view which leads to a crash
	when trying the latter. Fixes bug #148955.
2004-08-03 14:55:31 +00:00
Michael Natterer b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Michael Natterer 36d5f97bd0 don't leak the brush's name if parsing the shape fails.
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
	leak the brush's name if parsing the shape fails.

	(gimp_brush_generated_dirty): shut up bogus compiler warnings
	about uninitialized variables.
2004-08-03 12:56:19 +00:00
Shlomi Fish 9959cc2ead plug-ins/imagemap/imap_preview.c ported to GimpPreviewArea.
* plug-ins/imagemap/imap_preview.c
* plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.
2004-08-03 11:35:59 +00:00
David Odin 9886b1951f ported to GimpPreviewArea.
* plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.
2004-08-03 10:43:29 +00:00
David Odin a2fd420dbd converted to GimpPreviewArea.
* plug-ins/fp/fp.c: converted to GimpPreviewArea.
2004-08-03 00:58:10 +00:00
David Odin 7f60b3eb9a plug-ins/rcm/rcm_callback.c plug-ins/rcm/rcm_dialog.c Ported to
* plug-ins/rcm/rcm_callback.c
* plug-ins/rcm/rcm_dialog.c
* plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.
2004-08-02 22:16:35 +00:00
Simon Budig 7f95f04342 Fixed brush spacing for brushes with >= 2 spikes. Spotted by Joao S. O.
2004-08-02  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
	with >= 2 spikes. Spotted by Joao S. O. Bueno.

	Fixes bug #149099.
2004-08-02 21:34:12 +00:00
Hans Breuer 44f617d85b [commited mostly yesterday, but ChangeLog was missing]
2004-08-01  Hans Breuer  <hans@breuer.org>
	[commited mostly yesterday, but ChangeLog was missing]

	* app/display/makefile.msc app/widgets/makefile.msc : build
	but *dont link* display-enums.obj, widget-enums.obj and
	gimpdisplayoptions.obj. They must be in the dll
	* app/makefile.msc : build gimp.exe and gimp-console.exe both
	using the same gimp-core.dll
	* app/gimpcore.def : new file, exports for gimp-core.dll
	* app/Makefile.am : added to EXTRA_DIST

	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
	* cursors/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc : updated

	* app/main.c app/app_procs.c : moved code to close the console
	from the former to the later. It only is to be used if The Gimp
	is not build as console app.

	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
	drawable twice
	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
	crashing on File/Import
2004-08-02 18:34:01 +00:00
David Odin ff27b1f157 ported to GimpPreviewArea.
* plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.
2004-08-02 08:51:49 +00:00
David Odin b099e695e7 ported to GimpPreviewArea.
* plug-ins/common/video.c: ported to GimpPreviewArea.
2004-08-02 08:18:16 +00:00
David Odin 4977f8a7c2 ported to GimpPreviewArea. Centered the preview, too.
* plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
  preview, too.
2004-08-01 22:40:47 +00:00
David Odin e62343c737 ported to GimpPreviewArea.
* plug-ins/common/tileit.c: ported to GimpPreviewArea.
2004-08-01 21:59:13 +00:00
David Odin c5f67ae992 ported to GimpPreviewArea.
* plug-ins/common/sinus.c: ported to GimpPreviewArea.
2004-08-01 20:54:09 +00:00
Manish Singh 182c9b16e2 Really really really fix WINDRES logic.
2004-08-01  Manish Singh  <yosh@gimp.org>

        * configure.in: Really really really fix WINDRES logic.
2004-08-01 20:30:50 +00:00
Manish Singh b83ce07108 update install-% rule to match newer libtool commands.
2004-08-01  Manish Singh  <yosh@gimp.org>

        * plug-ins/common/mkgen.pl: update install-% rule to match newer
        libtool commands.

        * plug-ins/common/Makefile.am: regenerated.
2004-08-01 20:13:27 +00:00
Manish Singh beb1608115 Really really fix WINDRES logic.
2004-08-01  Manish Singh  <yosh@gimp.org>

        * configure.in: Really really fix WINDRES logic.
2004-08-01 20:00:12 +00:00
Manish Singh f21c4caefb Really fix WINDRES logic.
2004-08-01  Manish Singh  <yosh@gimp.org>

        * configure.in: Really fix WINDRES logic.
2004-08-01 19:55:40 +00:00
David Odin eaa8a2a51c ported to GimpPreviewArea.
* plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.
2004-08-01 19:43:06 +00:00
Simon Budig b05f9f4b60 Fixed oversight that accidentially reset the number of spikes to 2.
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
	reset the number of spikes to 2.
2004-08-01 18:09:41 +00:00
Simon Budig 1eb3009f1a Added optional spikes for the generated brushes, enabling star shaped
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
	the generated brushes, enabling star shaped generated brushes.

	* app/widgets/gimpbrusheditor.[ch]: GUI for this.

	* app/core/gimpbrush.c: changed accordingly.
2004-08-01 17:20:00 +00:00