Commit Graph

13337 Commits

Author SHA1 Message Date
Sven Neumann 32b019ffa9 applied patch from Markus Triska that improves which layers are choosen by
2004-08-28  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/compose.c (compose_dialog): applied patch from
	Markus Triska that improves which layers are choosen by
	default (bug #148172).
2004-08-28 12:10:48 +00:00
Sven Neumann 804788c120 applied a patch from Eric Cheung that changes the function to use a GQueue
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-contiguous-region.c
	(find_contiguous_region_helper): applied a patch from Eric Cheung
	that changes the function to use a GQueue to implement recursion
	instead of recursive function calls. Fixes bug #151124.

	* plug-ins/common/noisify.c (noisify_dialog): left-align the
	preview.
2004-08-28 11:48:00 +00:00
Sven Neumann 52bf83ee69 app/widgets/gimphelp-ids.h added a help-id for the image area.
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h
	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
	help-id for the image area.
2004-08-28 10:57:24 +00:00
Sven Neumann e3ac5708aa merged fixes from stable branch.
2004-08-27  Sven Neumann  <sven@gimp.org>

	* de.po: merged fixes from stable branch.
2004-08-27 20:53:12 +00:00
Michael Natterer 50ee45d79a added missing file. 2004-08-27 20:20:35 +00:00
Michael Natterer d7f73e6f8a Moved the gimp_progress_init() and gimp_progress_update() PDB functions to
2004-08-27  Michael Natterer  <mitch@gimp.org>

	Moved the gimp_progress_init() and gimp_progress_update() PDB
	functions to their own group because they don't belong to the
	"Plug-In" namespace and will soon get more functions.

	* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...

	* tools/pdbgen/pdb/progress.pdb: ...and added it here.

	* tools/pdbgen/Makefile.am
	* tools/pdbgen/groups.pl
	* app/pdb/Makefile.am
	* libgimp/Makefile.am: changed accordingly.

	* libgimp/gimpprogress_pdb.[ch]: new generated files.

	* app/pdb/internal_procs.c
	* app/pdb/plug_in_cmds.c
	* libgimp/gimp_pdb.h
	* libgimp/gimpplugin_pdb.[ch]: regenerated.
2004-08-27 20:06:17 +00:00
Michael Natterer 28e1f2a9da call gimp_container_editor_select_item() manually at construction time so
2004-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_construct): call
	gimp_container_editor_select_item() manually at construction time
	so views show the initially selected object's state correctly
	(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 17:38:57 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
Sven Neumann c27a5a30a6 fixed Wiki syntax in output.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* fortunes.xsl: fixed Wiki syntax in output.
2004-08-26 19:43:51 +00:00
Sven Neumann 10dd89960c Makefile.am added simple XSL transformation to generate fortunes for
2004-08-26  Sven Neumann  <sven@gimp.org>

	* Makefile.am
	* fortunes.xsl: added simple XSL transformation to generate
	fortunes for wiki.gimp.org from gimp-tips.xml.in.
2004-08-26 18:15:10 +00:00
Michael Natterer f1d0db6d99 removed "gboolean use_default_values" from GimpItem::stroke().
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
	from GimpItem::stroke().

	* app/core/gimpchannel.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: changed accordingly.
2004-08-26 16:33:42 +00:00
Michael Natterer 23bd12162d implement the whole paint_options fiddling here instead of in each
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c (gimp_item_stroke): implement the whole
	paint_options fiddling here instead of in each subclass and pass
	either GimpStrokeOptions or GimpPaintOptions (instead of
	GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().

	Also copied code (that needs to be abstracted to a utility
	function) from the tool_manager which makes sure we really use the
	global brush, pattern etc. if these options are checked in prefs.
	Fixes bug #150716.

	* app/core/gimpchannel.c (gimp_channel_stroke)
	* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
	duplicated code mentioned above and simply use the paint_options
	passed.
2004-08-26 16:06:13 +00:00
Michael Natterer e919974b52 app/app-docs.sgml app/app-sections.txt updated.
2004-08-26  Michael Natterer  <mitch@gimp.org>

	* app/app-docs.sgml
	* app/app-sections.txt
	* app/app.types: updated.
2004-08-26 15:20:09 +00:00
David Odin 5af63086ba GimpViewRendererVector is really derived from GimpViewRenderer and not
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
  really derived from GimpViewRenderer and not from GimpViewRendererDrawable.
2004-08-26 14:59:31 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
Sven Neumann db6dff283f try to convert the result of gimp_directory() to UTF-8 and bail out with a
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/sanity.c (sanity_check_filename_encoding): try to convert
	the result of gimp_directory() to UTF-8 and bail out with a
	moderately helpful error message if this conversion fails. Works
	around bug #150917. Also marked these strings for translation.
2004-08-26 09:48:32 +00:00
Sven Neumann 7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
Sven Neumann b80d513c1d minor update.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* de.po: minor update.
2004-08-26 08:18:30 +00:00
David Odin d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
Manish Singh b6d3a912fd Guard against bogus logical screen dimensions. Fixes bug #151053.
2004-08-25  Manish Singh  <yosh@gimp.org>

        * plug-ins/common/gifload.c: Guard against bogus logical screen
        dimensions. Fixes bug #151053.
2004-08-25 22:32:54 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann e6a034fc2d app/app-docs.sgml app/app-sections.txt updated.
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/app-docs.sgml
	* app/app-sections.txt
	* app/app.types: updated.
2004-08-25 20:22:53 +00:00
Sven Neumann 8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
William Skaggs c92a38626b Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
2004-08-25 18:26:06 +00:00
Sven Neumann da66a8db22 updated.
2004-08-25  Sven Neumann  <sven@gimp.org>

	* POTFILES.in: updated.
2004-08-25 18:02:07 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin 54fa5a0af9 eradicate some more previews in favor of views.
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
  in favor of views.
2004-08-25 17:54:12 +00:00
William Skaggs 856b87b105 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/Makefile.am: added ggr.txt to list.
2004-08-25 17:50:35 +00:00
William Skaggs 21ba16c67d Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: added new file decribing the ggr
	(Gimp gradient) file format.
2004-08-25 17:41:34 +00:00
David Odin f168881c18 app/display/gimpnavigationview.c renamed these files to...
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...

* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
  changed GimpNavigationView to GimpNavigationEditor since it is really
  inherited from GimpEditor anyway.

This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.

* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 16:02:10 +00:00
Michael Natterer da34232a04 print bad '%' sequences literally instead of warning (g_warning() is for
2004-08-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): print bad '%' sequences
	literally instead of warning (g_warning() is for programming
	errors only and must never be triggered by bad or intermediate
	user input). Fixes bug #150676
2004-08-25 14:38:49 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Roman Joost f86f328277 updated and removed fuzzy strings
2004-08-24  Roman Joost	<romanofski@gimp.org>

	* de.po: updated and removed fuzzy strings
2004-08-24 20:34:06 +00:00
Sven Neumann 6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann 7894cacc3b added pa.po (Punjabi).
2004-08-24  Sven Neumann  <sven@gimp.org>

	* Makefile.am (tips_POFILES): added pa.po (Punjabi).
2004-08-23 23:17:32 +00:00
Amanpreet Singh Alam 7e7e2fa2f3 add 2004-08-23 15:03:19 +00:00
Sven Neumann 509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
David Odin f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann 0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Simon Budig e86dff66da Implemented the ellipse basic shape differently to avoid possible rounding
2004-08-22  Simon Budig  <simon@gimp.org>

	* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
	shape differently to avoid possible rounding issues with
	the _arcto () command.

	* app/vectors/gimpvectors-import.c: properly close the rounded
	rectangles.
2004-08-22 12:31:47 +00:00
Sven Neumann d6a016b4b4 support optional center coordinates for the "rotate" transformations.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c (parse_svg_transform): support
	optional center coordinates for the "rotate" transformations.
	(parse_svg_transform): apply transformations in reverse order. The
	SVG spec is rather confusing here.
2004-08-22 10:50:22 +00:00
Sven Neumann 323e7f4cc0 updated 2004-08-21 15:54:14 +00:00
Sven Neumann 59e521c64f fixed a bug I introduced with my last commit.
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
	a bug I introduced with my last commit.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
2004-08-21 15:47:31 +00:00
Sven Neumann 6f3c1ae503 added new function gimp_bezier_stroke_new_ellipse() that provides a simple
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpbezierstroke.[ch]: added new function
	gimp_bezier_stroke_new_ellipse() that provides a simple API to
	create a bezier stroke that represents an ellipse.

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "circle" and "ellipse".
2004-08-21 13:50:19 +00:00
Simon Budig 5dd10c748d Fix some GUI issues. Make the relation between the dimension parameter and
2004-08-21  Simon Budig  <simon@gimp.org>

	* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
	between the dimension parameter and the rank thingies more clear
	also changed to a nicer layout.
2004-08-21 10:38:38 +00:00
Sven Neumann e63c6511fd added support for the basic SVG shapes "polyline" and "polygon".
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for the basic
	SVG shapes "polyline" and "polygon".
2004-08-21 09:41:12 +00:00
Sven Neumann 905fcfd6b5 added support for importing the basic SVG shape "line". Other shapes will
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/vectors/gimpvectors-import.c: added support for importing
	the basic SVG shape "line". Other shapes will follow...
2004-08-21 08:03:39 +00:00
Sven Neumann c9ef65d045 formatting fixups 2004-08-20 23:01:18 +00:00