Commit Graph

151 Commits

Author SHA1 Message Date
Michael Natterer 19ea2a9db4 app/widgets/Makefile.am new files keeping the render acceleration check
2005-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimprender.[ch]: new files keeping the render
	acceleration check buffers.

	* app/display/gimpdisplayshell-render.[ch]: removed them here.

	* app/gui/gui.c: initialize/shutdown the new buffers.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c: use the new stuff. Removes
	lots of broken widgets -> display dependencies.
2005-07-19 20:42:14 +00:00
Michael Natterer c0a10c8303 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-07-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppaletteview.[ch]: new widget which manages the
	selected palette entry itself and emits "selected", "activated"
	and "context" signals. Not used yet.

	* app/widgets/gimpviewrendererpalette.[ch]: reimplemented palette
	drawing: added optional grid drawing and APIs to configure the
	renderer. Should be ready for the palette editor now.
2005-07-14 14:41:29 +00:00
Michael Natterer 98dc0a67b7 app/widgets/Makefile.am app/widgets/widgets-types.h new view renderer,
2005-07-13  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererpalette.[ch]: new view renderer,
	does nothing yet except chaining up in ::render().

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_by_viewable_type): use it for palettes.
2005-07-13 20:11:24 +00:00
Sven Neumann a8318e18c5 added utility functions to copy and to free a dash pattern.
2005-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdashpattern.[ch]: added utility functions to copy
	and to free a dash pattern.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendererdashes.[ch]: added a simple cell
	renderer to visualize a dash pattern.

	* app/widgets/gimpstrokeeditor.c: show previews of the dash
	presets in the combo-box.
2005-05-21 20:24:42 +00:00
Michael Natterer 1f1305c372 Some dock refactoring which separates the docking logic from active image
2005-05-11  Michael Natterer  <mitch@gimp.org>

	Some dock refactoring which separates the docking logic from
	active image and UI manager stuff:

	* app/widgets/gimpmenudock.[ch]: new widget renamed from
	GimpImageDock, zero changes except the name change.

	* app/widgets/gimpimagedock.[ch]: new widget derived from
	GimpDock. Keeps the UI manager.

	* app/widgets/gimpdock.[ch]: removed the UI manager. GimpDock only
	contains the basic docking logic again.

	* app/widgets/gimpmenudock.[ch]
	* app/widgets/gimptoolbox.[ch]: derive them from GimpImageDock.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/actions/dialogs-commands.c
	* app/actions/dock-actions.c
	* app/actions/dock-commands.c
	* app/actions/dockable-commands.c
	* app/dialogs/dialogs-constructors.c: changed accordingly.
2005-05-11 20:26:12 +00:00
Michael Natterer 92ad7c1d53 app/widgets/Makefile.am app/widgets/widgets-types.h new widget which
2005-05-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerlist.[ch]: new widget which allows
	adding/removing controllers using two lists of available/active
	controllers. Work in progress...

	* app/widgets/gimpcontrollerinfo.[ch]: derive it from GimpVieable
	so it can have an icon (unfinished). Added convenience constructor
	gimp_controller_info_new().

	* app/dialogs/preferences-dialog.c: use a GimpControllerList
	instead of a notebook of GimpControllerEditors.
2005-05-09 09:35:41 +00:00
Michael Natterer 7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
Michael Natterer dba31b149c More unfinished replacement for the info window:
2005-04-05  Michael Natterer  <mitch@gimp.org>

	More unfinished replacement for the info window:

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpimagepropview.[ch]: new widget showing an image's
	size, resolution, mode, memsize etc.

	* app/dialogs/Makefile.am
	* app/dialogs/image-properties-dialog.[ch]: a dialog keeping the
	widget.

	* app/widgets/gimphelp-ids.h: a help ID for the dialog.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* menus/image-menu.xml.in: action and menu entry for the dialog.
2005-04-04 22:34:29 +00:00
Michael Natterer 0231374c86 added new signals "sample-point-added" and "sample-point-removed" and
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added new signals "sample-point-added"
	and "sample-point-removed" and public functions to emit them.

	* app/core/gimpimage-sample-points.c (gimp_image_add_sample_point)
	(gimp_image_remove_sample_point): emit them accordingly.

	* app/core/gimpimage-undo-push.c (undo_pop_image_sample_point):
	ditto.

	(undo_pop_image_guide)
	(undo_pop_image_sample_point): added comments why we add/remove
	stuff manually instead of using the GimpImage APIs.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcursorview.[ch]
	* app/widgets/gimpsamplepointeditor.[ch]: new widgets.
	GimpCursorView is a replacement for the info window's "Cursor"
	page, GimpSamplePointEditor is a view on an image's sample points.
	The sample point editor does nothing yet except keeping a 2x2 grid
	of GimpColorFrames. Addresses bug #137776.

	* app/dialogs/dialogs.c
	* app/dialogs/dialogs-constructors.[ch]: register the new widgets
	as dockable dialogs.

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* menus/dialogs-menuitems.xml: added actions and menu items for
	the new dialogs.

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor)
	(gimp_display_shell_clear_cursor): update the new cursor view.

	* app/widgets/gimphelp-ids.h: help IDs for the new dialogs.

	* app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode):
	changed description "Pixel values" to "Pixel" because the former
	was too long.
2005-04-03 15:48:03 +00:00
Sven Neumann 3ba107f1f9 app/widgets/Makefile.am app/widgets/gimpfgbgview.[ch] added new widget
2005-03-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpfgbgview.[ch]
	* app/widgets/widgets-types.h: added new widget GimpFgBgView;
	somewhat similar to GimpFgBgEditor but a lot simpler.

	* app/widgets/gimpcoloreditor.c: use GimpFgBgView as preview widget.
	Closes bug #168592.

	* app/widgets/gimpfgbgeditor.c: gracefully handle a very small
	size allocation.
2005-03-31 13:39:18 +00:00
Sven Neumann 0bc3233be7 app/widgets/Makefile.am new files.
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpdnd-xds.[ch]: new files.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/widgets-enums.h: added a basic XDS (Direct Save
	Protocol) implementation.

	* app/widgets/gimpimageview.c: allow to save images by dragging
	them from the Images dialog to an XDS capable file manager.
2005-03-25 14:23:35 +00:00
Sven Neumann 9511753a02 check for gthread-2.0 unless the --disable-mp option is given.
2005-02-13  Sven Neumann  <sven@gimp.org>

	* configure.in: check for gthread-2.0 unless the --disable-mp
	option is given.

	* app/app_procs.c (app_libs_init): call g_thread_init().

	* app/base/pixel-processor.c: ported to GThread.

	* app/Makefile.am
	* app/*/Makefile.am: use @GTHREAD_CFLAGS@.
2005-02-13 15:08:08 +00:00
William Skaggs 6d74b06daf Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpenumwidgets.c
	* app/widgets/gimpenumwidgets.h: magic-moved from here...

	* libgimpwidgets/gimpenumwidgets.c
	* libgimpwidgets/gimpenumwidgets.h: ...to here.

	* app/dialogs/convert-dialog.c
	* app/dialogs/layer-add-mask-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/Makefile.am
	* app/widgets/gimpbrusheditor.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h: all changed accordingly.
	Still need to do devel-docs.
2005-01-29 01:08:20 +00:00
Sven Neumann 3069695265 app/widgets/Makefile.am app/widgets/widgets-types.h
2005-01-21  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpenumcombobox.[ch]
	* app/widgets/gimpenumstore.[ch]: moved GimpEnumStore and
	GimpEnumComboBox from here ...

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpenumcombobox.[ch]
	* libgimpwidgets/gimpenumstore.[ch]: ... to libgimpwidgets.

	* app/dialogs/convert-dialog.c
	* app/dialogs/scale-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorframe.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpstrokeeditor.c
	* data/images/gimp-splash.png: changed includes accordingly.
2005-01-21 22:59:51 +00:00
Michael Natterer 40928bb578 use a GtkUIManager instead of a GtkItemFactory. Added virtual function
2004-11-04  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
	of a GtkItemFactory. Added virtual function ::get_action_type()
	and create the manager's actions manually using that action type
	instead of using gtk_action_group_add_actions().

	* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
	creates GimpActions (which can have a color attached) instead of
	GtkActions. Changed the menu item visibility and color preview
	code accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpitemfactory.[ch]: finally removed.

	* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
2004-11-04 12:15:49 +00:00
Michael Natterer ea1b88f580 app/widgets/Makefile.am app/widgets/widgets-types.h new widget built from
2004-10-26  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
	preliminary code from the prefs dialog. Prerequisite for finally
	fixing bug #106920.

	* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 12:26:47 +00:00
Michael Natterer 6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Sven Neumann 8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann 22a1384b5a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.

	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
	properties does matter.

	* app/dialogs/Makefile.am
	* app/dialogs/scale-dialog.[ch]: added first version of a new
	Scale dialog in an attempt to address bug #151022.

	* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 14:59:14 +00:00
Michael Natterer eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Sven Neumann 0527d02329 themes/Default/images/Makefile.am added a stock icon that shows a simple
2004-09-27  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-frame-64.png: added a stock icon
	that shows a simple drop shadow but could be exchanged for other
	image decorations.

	* libgimpwidgets/gimpstock.[ch]: register the new icon.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
	ugly code to draw a frame around a preview pixbuf.

	* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
	to the GimpViewRenderer class so it can be shared by all renderers.

	* app/widgets/gimpviewrendererimagefile.c: use the new functionality
	to draw a nice frame around imagefile previews.

	* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-27 19:40:12 +00:00
Michael Natterer 96a27b59cf app/actions/brushes-actions.c app/actions/gradients-actions.c
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/brushes-actions.c
	* app/actions/gradients-actions.c
	* app/actions/palettes-actions.c
	* app/actions/patterns-actions.c: made the "foo-edit" actions
	GimpStringActions and pass the identifier of the editor dialog
	to the callback.

	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
	show the editor dialog here instead of calling view->edit_func().

	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
	gradient and palette edit_funcs.

	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.

	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
	member and parameters and create the edit button unconditionally.

	* app/widgets/gimpbrushfactoryview.[ch]
	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.

	* app/widgets/Makefile.am
	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
	needed any longer.

	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
	and follow the edit_func removal.

	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
	stuff.

	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 10:45:49 +00:00
Michael Natterer ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug #152531
2004-09-14 12:06:28 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Michael Natterer 06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Sven Neumann 744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
Michael Natterer 62bf62a151 app/core/gimpmarshal.list app/widgets/Makefile.am
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
	which displays an accelerator and allows to edit it (ripped
	out of libegg and modified).

	* app/widgets/gimpactionview.c: use the new renderer and connect
	to its "accel-edited" signal (its callback is one huge mess that
	needs to be cleaned up). Added ugly hack to work around GTK+ API
	limitation that seems to prevent implementing a shortcut editor in
	a sane way.

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/tools-actions.c: added ugly hacks here, too.

	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
	editor by Close.
2004-07-21 00:39:46 +00:00
Michael Natterer 94fc8f15a1 app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties
2004-07-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionfactory.[ch]
	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
	properties to GtkActionGroup and allow to register them in the
	GimpActionFactory.

	* app/actions/actions.c: register user visible labels and icons
	with all action groups.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactionview.[ch]: new widget which shows a
	treeview of action groups and their actions & shortcuts.

	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
	utility function.

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_get_accel_string() utility function.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_ui_manager() which will be used for setting
	up the controller mapping dialog.

	* app/gui/preferences-dialog.c: added a "Configure Keyboard
	Shortcuts" button which pops up a GimpControllerView. Work in
	progress...
2004-07-20 18:50:20 +00:00
Sven Neumann ccf8ed69e7 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
	a treeview on file procedures.

	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
	menu with the new GimpFileProcView widget.
	(gimp_file_dialog_set_image): reset the file type to Automatic
	(fixes bug #141535).

	* app/actions/file-commands.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: changed accordingly.

	* plug-ins/common/bz2.c
	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
	extension. It's redundant and breaks the code that sets the
	extension from the selected file-type.

	* plug-ins/common/dicom.c: register a shorter menu label.

	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* plug-ins/common/url.c: register stock icons.
2004-07-16 21:24:39 +00:00
Michael Natterer 8d9e362249 app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch]
2004-07-09  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppdbdialog.[ch]
	* app/widgets/gimpdataselect.[ch]
	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]
	* app/widgets/gimpfontselect.[ch]: ...and added here as a
	hierarchy of widgets.

	* app/widgets/gimpdatafactoryview.h: removed typdef
	GimpDataEditFunc, it's in widgets-types.h now.

	* app/gui/convert-dialog.c: changed accordingly.

	* app/core/gimp.[ch]: added vtable entries for creating, closing
	and setting PDB dialogs.

	* app/gui/gui-vtable.c: implement the vtable entries using the new
	widgets.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
	the Gimp object to create / manage the selection dialogs. The
	generated files don't depend on GUI stuff any longer.

	* app/pdb/brush_select_cmds.c
	* app/pdb/font_select_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/palette_select_cmds.c
	* app/pdb/pattern_select_cmds.c: regenerated.
2004-07-09 19:14:59 +00:00
Michael Natterer 8fc8cb487c app/gui/Makefile.am removed...
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/gimpclipboard.[ch]: ...and added here.

	* app/actions/edit-commands.c
	* app/gui/gui.c: changed accordingly.
2004-07-07 14:38:23 +00:00
Michael Natterer 667de3c9f4 app/widgets/Makefile.am new files containing the code which
2004-06-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpselectiondata.[ch]: new files containing the
	code which encodes/decodes all sorts of stuff to/from its
	GtkSelectionData representation. Used to live in gimpdnd.c

	* app/widgets/gimpdnd.c: use the new functions (unclutters the
	file quite a bit), converted tabs to spaces.
2004-06-28 20:39:54 +00:00
Michael Natterer 02b91f6628 app/tools/gimptool.[ch] added boolean return value to
2004-06-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: added boolean return value to
	GimpTool::key_press() which indicates if the event was handled.

	* app/tools/gimpcroptool.c
	* app/tools/gimpeditselectiontool.[ch]
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: return TRUE if the key event was handled.

	* app/tools/gimppainttool.c: removed key_press() implementation.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
	which takes GdkEventKey and emits controller events for all
	combinations of modifiers and cursor keys.

	* app/widgets/gimpcontrollers.[ch]: added new function
	gimp_controllers_get_keyboard().

	* app/display/gimpdisplayshell-callbacks.c: if a key event was not
	handled by the active tool, dispatch it to the keyboard controller.

	* etc/controllerrc: add a keyboard controller which is configured
	to do the same as the removed gimp_paint_tool_key_press().
2004-06-24 10:16:08 +00:00
Michael Natterer ba2e6c675f app/widgets/Makefile.am app/widgets/widgets-types.h made an object out of
2004-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
	the GimpControllerInfo struct.

	* app/widgets/gimpcontrollers.c: changed accordingly.
2004-06-16 11:11:32 +00:00
Michael Natterer d0117ef5b9 Started to fix bug #106920 in a more genreral way:
2004-06-16  Michael Natterer  <mitch@gimp.org>

	Started to fix bug #106920 in a more genreral way:

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
	which provides an API for pluggable input controller modules
	(mouse wheel, usb/midi stuff etc.).

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
	which maps wheel mouse scroll events to controller events.

	* app/widgets/gimpcontrollers.[ch]: manager for controllers.
	reads $(gimpdir)/controllerrc and keeps a mapping of controller
	events to GtkActions.

	* app/gui/gui.c: initialize and shut down the controller stuff.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): if a wheel controller
	exists, dispatch GdkEventScroll to it first and return if it was
	handled.
2004-06-15 22:59:26 +00:00
Michael Natterer dbc49d9a11 app/widgets/Makefile.am new toolbox area which shows the active image.
2004-05-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which
	shows the active image.

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added config options to control the
	visibility of the toolbox' color, indicator and image areas.

	* app/widgets/gimptoolbox.[ch]: added the image area and honor the
	new config options. Put the various areas into their own wrap box.

	* app/widgets/gimptoolbox-dnd.c: changed accordingly.

	* app/widgets/gimphelp-ids.h: added a help ID for the image area.

	* app/widgets/gimptoolbox-indicator-area.c: made the previews
	a bit larger, cleanup.

	* app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for
	the new config options.

	* themes/Default/images/preferences/Makefile.am
	* themes/Default/images/preferences/toolbox.png: a (wrong) icon
	for the "Toolbox" prefs page. Needs to be replaced.
2004-05-31 20:30:52 +00:00
Sven Neumann 4c03f0156c app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-05-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainerentry.[ch]: added new widget
	GimpContainerEntry, a GtkEntry with completion that implements the
	GimpContainerView interface.

	* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
	GimpContainerEntry to select the font.
2004-05-31 17:53:25 +00:00
Michael Natterer 855eedf396 added enum GimpActiveColor which can be one of { FOREGROUND, BACKGROUND },
2004-05-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which
	can be one of { FOREGROUND, BACKGROUND },

	* app/widgets/Makefile.am
	* app/widgets/gimpfgbgeditor.[ch]: new widget implementing the
	FG/BG/Swap/Default color area known from the toolbox.

	* app/widgets/gimptoolbox-color-area.c: use the new widget.

	* app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and
	the color area by a GimpFgBgEditor.
2004-05-27 12:41:22 +00:00
Michael Natterer 2849cf23e5 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkAction subclass
2004-05-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpaction.[ch]: new GtkAction subclass which can
	show either a color or viewable preview in GtkImageMenuItem
	proxies.

	* app/widgets/gimpenumaction.[ch]
	* app/widgets/gimppluginaction.[ch]
	* app/widgets/gimpstringaction.[ch]: derive them from GimpAction.

	* app/widgets/gimpactiongroup.c (gimp_action_group_add_actions):
	add GimpActions, not GtkActions.

	(gimp_action_group_set_action_color)
	(gimp_action_group_set_action_viewable): removed all hacks and
	simply set the "color" or "viewable" properties of the GimpAction
	to change. Fixes color/viewable previews in menus.

	* app/actions/file-actions.c: show previews in the "Open Recent"
	menu items.

	Unrelated:

	* app/widgets/widgets-types.h: removed GimpDockedInterface typedef...

	* app/widgets/gimpdocked.h: ...and added it here. We don't have
	class struct typedefs in the types header either.

	* app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut
	for "edit-fill-pattern".

	* app/actions/gradient-editor-actions.c: added some stock IDs.
	Please comment.
2004-05-19 20:56:37 +00:00
Michael Natterer 8fbc7e2daf app/widgets/Makefile.am app/widgets/widgets-types.h
2004-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainermenu.[ch]
	* app/widgets/gimpcontainermenuimpl.[ch]
	* app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by
	GimpContainerViewInterface implemented by GimpContainerComboBox.
2004-05-11 16:14:03 +00:00
Sven Neumann 5de9756f9a app/widgets/Makefile.am app/widgets/widgets-types.h added new widget,
2004-05-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainercombobox.[ch]: added new widget, almost
	finished.

	* app/widgets/gimpcontainerview.[ch]: added convenience functions
	to get and set the GimpContainerView properties.

	* app/widgets/gimpcontainerbox.c: use the convenience functions.

	* app/gui/file-new-dialog.c: use the new GimpContainerComboBox.

	* etc/templaterc: use "pixels" as the unit for pixel sized templates.
2004-05-11 12:13:31 +00:00