Commit Graph

1281 Commits

Author SHA1 Message Date
Sven Neumann cef9db57fe renamed gimp_drawable_data() to gimp_drawable_get_tiles().
2006-04-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdrawable.[ch]: renamed gimp_drawable_data() to
	gimp_drawable_get_tiles().

	[lots of files]: changed accordingly.
2006-04-07 09:21:18 +00:00
Sven Neumann 03b750a40e reduced precision of the display of time since the last change.
2006-04-03  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c: reduced precision of the
	display of time since the last change.
2006-04-03 10:13:41 +00:00
Sven Neumann 5439aa4995 did a global gdisp -> display substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gdisp -> display substitution.
2006-03-28 17:55:52 +00:00
Sven Neumann 905fdfcbed did a global gimage -> image substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gimage -> image substitution.
2006-03-28 17:08:36 +00:00
Michael Natterer 2ed407b54f app/tools/gimptool.[ch] add "gboolean proximity" parameter to
2006-03-25  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptool.[ch]
	* app/tools/tool_manager.[ch]: add "gboolean proximity" parameter
	to GimpTool::oper_update() in order to emphasize its importance
	and to avoid peeking around in the GimpDisplayShell struct.

	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpclonetool.c
	* app/tools/gimpcolorpickertool.c
	* app/tools/gimpcolortool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpforegroundselecttool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimpnewrectselecttool.c
	* app/tools/gimppainttool.c
	* app/tools/gimprectangletool.[ch]
	* app/tools/gimpselectiontool.c
	* app/tools/gimptransformtool.c
	* app/tools/gimpvectortool.c: changed accordingly. Got rid of
	quite some "display/gimpdisplayshell.h" includes.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass shell->proximity to
	tool_manager_oper_update_active().
2006-03-25 14:23:09 +00:00
Sven Neumann 641952231e avoid code duplication by using a #define.
2006-03-23  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayoptions.c: avoid code duplication by
	using a #define.

	* app/config/gimpdisplayconfig.c: for fullscreen mode, default to
	the same settings as we do for normal editing mode.
2006-03-23 12:06:33 +00:00
Sven Neumann ac777da954 app/display/gimpdisplayshell-render.c app/display/gimpdisplayshell.[ch]
2006-03-17  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpforegroundselectoptions.[ch]
	* app/tools/gimpforegroundselecttool.c: allow to use red, green or
	blue for the selection preview used by the foreground selection tool.
2006-03-17 13:27:08 +00:00
Michael Natterer 6a01bb2306 added "show-tooltip" and "hide-tooltip" signals. Connect to each menu
2006-03-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added "show-tooltip" and
	"hide-tooltip" signals. Connect to each menu item's
	enter-notify-event and leave-notify-event. On enter, emit
	show-tooltip, on leave emit hide-tooltip.

	* app/display/gimpdisplayshell.c: connect to the menubar ui
	manager's show-tooltip and hide-tooltip signals and show the tip
	in the display's status bar.
2006-03-09 15:26:33 +00:00
Sven Neumann 2a0378acb5 keep a reference on the old image until the display is connected to the
2006-03-06  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay.c (gimp_display_reconnect): keep a
	reference on the old image until the display is connected to the
	new one. Fixes bug #333568.

	* app/display/gimpdisplay-handlers.c: fixed typo in comment.

	* app/actions/file-commands.c: cosmetics.
2006-03-06 17:35:40 +00:00
Sven Neumann 017278c111 app/dialogs/file-open-dialog.c app/display/gimpdisplayshell-dnd.c
2006-03-03  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb:
	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.[ch]
	* app/widgets/gimplayertreeview.c: pass the selected load procedure
	to file_open_layer() or NULL if none is selected. Fixes bug #333207.

	* app/pdb/fileops_cmds.c: regenerated.
2006-03-03 19:51:20 +00:00
Michael Natterer e1ceed5147 define GIMP_PARAM_STATIC_STRINGS which is G_PARAM_STATIC_NAME|NICK|BLURB.
2006-01-18  Michael Natterer  <mitch@gimp.org>

	* app/config/config-types.c: define GIMP_PARAM_STATIC_STRINGS
	which is G_PARAM_STATIC_NAME|NICK|BLURB. Also define
	GIMP_PARAM_READABLE, _WRITABLE and _READWRITE which include
	GIMP_PARAM_STATIC_STRINGS.

	* app/*/*.c: use them for all object properties so their
	strings are not copied.
2006-01-18 20:29:40 +00:00
Michael Natterer 5236dc6f13 app/actions/dockable-actions.c app/actions/dockable-commands.[ch]
2006-01-17  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]
	* app/dialogs/dialogs-constructors.[ch]
	* app/dialogs/dialogs.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcomponenteditor.[ch]
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerentry.[ch]
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainerpopup.[ch]
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpcontainerview.[ch]
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdialogfactory.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimpfontview.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpimageview.[ch]
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppatternfactoryview.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.[ch]
	* app/widgets/gimpsessioninfo.[ch]
	* app/widgets/gimptemplateview.[ch]
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimptoolview.[ch]
	* app/widgets/gimpundoeditor.[ch]
	* app/widgets/gimpviewablebox.c
	* app/widgets/gimpviewablebutton.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/widgets/gimpviewrenderer.c: change the word "preview" to
	"view" whereever we talk about GimpView or GimpViewRenderer
	objects or their sizes. Ther were renamed from "Preview" a long
	time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
Sven Neumann a896bd1534 commented out gravity setting. While it's nice with
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_new):
	commented out gravity setting. While it's nice with
	"resize-windows-on-zoom", it doesn't yield satisfying behaviour in
	most cases.
2005-12-29 22:23:29 +00:00
Sven Neumann b07cbb500f fiddle with the "focus-on-map" window hint to prevent the dialogs from
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.c (gimp_dialog_factories_show_foreach):
	fiddle with the "focus-on-map" window hint to prevent the dialogs
	from grabbing the focus away from the image window. Fixes bug #167762
	for window managers supporting this hint.

	* app/display/gimpdisplayshell-callbacks.c: removed redundant call
	to gdk_window_focus() that wasn't having the desired effect anyway.
2005-12-29 21:32:46 +00:00
Sven Neumann 8fec4cd8c1 split gimp_dialog_factories_toggle() into two functions. Turned the
2005-12-29  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: split
	gimp_dialog_factories_toggle() into two functions. Turned the
	tri-state into a simple boolean state. Dialogs are now either
	shown or not, without treating the toolbox any special.

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
2005-12-29 20:47:29 +00:00
Michael Natterer 0d4a10fee4 app/config/*.c app/core/*.c app/display/*.c app/text/*.c port to
2005-12-10  Michael Natterer  <mitch@gimp.org>

	* app/config/*.c
	* app/core/*.c
	* app/display/*.c
	* app/text/*.c
	* app/vectors/*.c: port to G_DEFINE_TYPE() and friends. Some related
	core reordering and cleanup.
2005-12-10 19:24:36 +00:00
Michael Natterer 2a2e74161d new function which destroys the GCs kept by the shell and unrealizes the
2005-11-26  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_unrealize):
	new function which destroys the GCs kept by the shell and
	unrealizes the navigation popup.
2005-11-26 22:02:11 +00:00
Michael Natterer 855c4efe30 cleaned up and reordered instance struct and functions. Renamed functions
2005-11-23  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptoolcontrol.[ch]: cleaned up and reordered
	instance struct and functions. Renamed functions so getters and
	setters actually have "get" and "set" in their names.

	* app/display/gimpdisplayshell-autoscroll.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpfliptool.c
	* app/tools/gimpforegroundselecttool.c
	* app/tools/gimpmagnifytool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimpmovetool.c
	* app/tools/gimpvectortool.c
	* app/tools/tool_manager.c: changed accordingly.
2005-11-23 19:14:05 +00:00
Michael Natterer 978c464b32 return TRUE only if the selection intersects with the viewport, as
2005-11-14  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_mask_bounds):
	return TRUE only if the selection intersects with the viewport, as
	expected by gimp_display_shell_selection_invis(), which is the
	only caller of this function. Fixes bug #319029.
2005-11-13 23:35:33 +00:00
Michael Natterer e3e53dca27 Fixed bug #316395:
2005-10-30  Michael Natterer  <mitch@gimp.org>

	Fixed bug #316395:

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* app/actions/quick-mask-actions.c (quick_mask_toggle_actions):
	added tooltips to action entries.

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): use
	gimp_widget_set_accel_help() to set the tooltip so it contains
	the accelerator.

	* app/dialogs/dialogs-constructors.c (dialogs_dockable_constructor):
	attach the dialog's identifier to the dockable widget (hack).

	* app/widgets/gimpdockbook.c (gimp_dockbook_get_tab_widget): use
	the attached identifier to find the action for this dockable in
	the dock's UI manager (HACK HACK). Use the found action to set
	a tooltip with accelerator.

	* app/widgets/gimpwidgets-utils.c (gimp_widget_set_accel_help):
	fixed bug in fallback code what should never be used.
2005-10-30 18:41:18 +00:00
Michael Natterer 3af60ead59 app/display/gimpdisplayshell-close.c app/widgets/gimpactionview.c
2005-10-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpactionview.c
	* modules/controller_midi.c: g_source_unref() GSources after
	attaching them.
2005-10-25 21:07:03 +00:00
Sven Neumann cadcdb9270 formatting.
2005-10-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-selection.c: formatting.
2005-10-18 15:27:56 +00:00
Sven Neumann 6912227651 added run-mode parameter to file_open_layer().
2005-10-17  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: added run-mode parameter to
	file_open_layer().

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass GIMP_RUN_INTERACTIVE to
	file_open_layer().

	* tools/pdbgen/pdb/fileops.pdb: export file_open_layer() to the PDB
	as file-load-layer.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-10-17 15:15:20 +00:00
Sven Neumann ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
Sven Neumann 06a27d219a applied patch from Robert Ögren that works around problem creating guides
2005-09-26  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): applied
	patch from Robert Ögren that works around problem creating guides
	with a tablet on Windows by enabling extension events for the
	rulers.  Fixes the first problem described in bug #168516.

	* configure.in: bumped version to 2.3.5.
2005-09-26 20:51:55 +00:00
Sven Neumann 1f0aff2b09 libgimpwidgets/gimpwidgets.def added gimp_zoom_model_zoom() and changed
2005-09-25  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpzoommodel.[ch]: added gimp_zoom_model_zoom()
	and changed gimp_zoom_model_get_fraction() to take a model instead
	of the zoom factor.

	* app/display/gimpdisplayshell.[ch]: use a GimpZoomModel for the
	display scale factor.

	* app/actions/image-commands.c
	* app/actions/view-actions.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-scale.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpnavigationeditor.c
	* app/display/gimpstatusbar.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimpmagnifytool.c: changed accordingly.
2005-09-25 17:03:03 +00:00
Michael Natterer 839752f8f6 reordered checks for the modifiers pressed on <Tab> so NumLock and friends
2005-09-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): reordered checks for
	the modifiers pressed on <Tab> so NumLock and friends don't
	interfere. Fixes bug #317118.
2005-09-25 13:15:22 +00:00
Sven Neumann 13ebb1ca2b added more values to the GimpZoomType enum.
2005-09-25  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgetsenums.h: added more values to the
	GimpZoomType enum.

	* libgimpwidgets/gimpzoommodel.c (gimp_zoom_model_zoom_step):
	handle the new enum values.

	* app/actions/view-commands.c (view_zoom_cmd_callback) use the new
	values.

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): cosmetics.
2005-09-25 12:10:01 +00:00
Michael Natterer 80a31bfe83 set "activates-default" on all spinbuttons.
2005-09-24  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	(gimp_display_shell_scale_dialog): set "activates-default" on all
	spinbuttons.
2005-09-24 18:45:02 +00:00
David Odin f94f48f130 Moved the GimpZoomType enum from here...
* app/widgets/widgets-enums.h: Moved the GimpZoomType enum from	here...

* libgimpwidgets/gimpwidgetsenums.h: ...to here.

* app/widgets/widgets-enums.c
* libgimpwidgets/gimpwidgetsenums.c: regenerated.

* app/display/gimpdisplayshell-scale.[ch]: removed
  gimp_display_shell_scale_zoom_step and
  gimp_display_shell_scale_get_fraction from here...

* libgimpwidgets/gimpzoommodel.[ch]: ... to here so we can use these
  utility functions in plug-ins and in the core.
  Also removed the step-size property since the zoom-model now use
  gimp_zoom_model_zoom_step.

* app/actions/view-commands.c
* app/display/gimpdisplayshell-title.c
* app/display/gimpdisplayshell.c
* app/tools/gimpmagnifytool.c: modified accordingly.

* libgimp/gimpzoompreview.c: don't pass any argument to the
  gimp_zoom_model_new function.

* libgimpwidgets/gimpwidgets.def: added gimp_zoom_model_zoom_step
  (gimp_zoom_model_get_fraction was already there)

* devel-docs/app/app-sections.txt: removed
  gimp_display_shell_scale_zoom_step and
  gimp_display_shell_scale_get_fraction.
2005-09-24 17:25:36 +00:00
Michael Natterer 1adf3d71af Did a global s/qmask/quick-mask/:
2005-09-19  Michael Natterer  <mitch@gimp.org>

	Did a global s/qmask/quick-mask/:

	* app/actions/qmask-actions.[ch]
	* app/actions/qmask-commands.[ch]
	* app/core/gimpimage-qmask.[ch]
	* menus/qmask-menu.xml
	* themes/Default/images/stock-qmask-off-16.png
	* themes/Default/images/stock-qmask-on-16.png: removed.

	* app/actions/quick-mask-actions.[ch]
	* app/actions/quick-mask-commands.[ch]
	* app/core/gimpimage-quick-mask.[ch]
	* menus/quick-mask-menu.xml
	* themes/Default/images/stock-quick-mask-off-16.png
	* themes/Default/images/stock-quick-mask-on-16.png: added.

	* app/actions/Makefile.am
	* app/actions/actions.c
	* app/core/Makefile.am
	* app/core/core-enums.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-undo.c
	* app/core/gimpimage.[ch]
	* app/core/gimpundo.[ch]
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-callbacks.[ch]
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.[ch]
	* app/menus/menus.c
	* app/widgets/gimphelp-ids.h
	* libgimpwidgets/gimpstock.[ch]
	* menus/Makefile.am
	* menus/image-menu.xml.in
	* themes/Default/images/Makefile.am: changed accordingly.
2005-09-19 12:44:06 +00:00
Sven Neumann f114cd8b10 use ngettext for plural forms.
2005-09-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c (gimp_time_since): use
	ngettext for plural forms.
2005-09-13 16:19:08 +00:00
Sven Neumann 83285f825e use ngettext for plural form.
2005-09-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): use ngettext for plural form.

	* app/dialogs/user-install-dialog.c: string fix (bug #316148).
2005-09-13 12:38:37 +00:00
Michael Natterer c440ddaf32 don't include "core/gimpmarshal.h", replaced '_' by '-' in property name.
2005-09-11  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.c: don't include "core/gimpmarshal.h",
	replaced '_' by '-' in property name.
2005-09-11 12:21:45 +00:00
Michael Natterer b10adabb5e Added parent window API to the GimpProgress interface and to the libgimp
2005-09-09  Michael Natterer  <mitch@gimp.org>

	Added parent window API to the GimpProgress interface and to
	the libgimp progress stuff. Might look strange, but does
	the right thing in almost all cases (image window, file dialog,
	script-fu dialog etc). Fixes bug #62988.

	* app/core/gimpprogress.[ch]: added GimpProgress::get_window()
	which should return a toplevel window ID if the progress is in a
	window that wants to be the transient parent of plug-in dialogs.

	* app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new
	function which returns the window handle of a GtkWindow's GdkWindow.

	* app/widgets/gimpfiledialog.c: implement ::get_window().

	* app/display/gimpdisplay.[ch]: ditto. Removed window handle API.

	* app/gui/gui-vtable.c: changed accordingly.

	* libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand):
	added GIMP_PROGRESS_COMMAND_GET_WINDOW.

	* app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window):
	new function. Also renamed some functions to match the
	GimpProgress interface, and not the legacy PDB procedure names.

	* tools/pdbgen/pdb/progress.pdb
	* app/core/gimppdbprogress.c: implement get_window() on both
	sides of the wire, keeping backward compatibility (hopefully).

	* libgimp/gimpprogress.[ch]: deprecated gimp_progress_install()
	and added gimp_progress_install_vtable() which takes a vtable with
	padding to be extensible. Added get_window() vtable entry and
	dispatch it accordingly. Also added pulse() which was implemented
	in a hackish way before. Everything is of course backward
	compatible.

	* libgimp/gimpprogressbar.c: inmplement the get_window() stuff
	so a plug-in dialog containing a progress can be the transient
	parent of another dialog in another plug-in.

	* libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function
	which returns a foreign GdkWindow of this plug-ins progress
	window.

	Renamed gimp_window_set_transient_for_default_display() to
	gimp_window_set_transient() and make it use the progress' window
	handle instead of the display's (which is the right thing to do in
	almost all cases).

	* libgimp/gimp.def
	* libgimp/gimpui.def: add the new functions.

	* tools/pdbgen/enums.pl
	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimpexport.c
	* plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
Sven Neumann ec56ef9d01 Address bug #307971:
2005-09-05  Sven Neumann  <sven@gimp.org>

	Address bug #307971:

	* app/core/gimp-gui.[ch]
	* app/display/gimpdisplay.[ch]
	* app/gui/gui-vtable.c
	* tools/pdbgen/pdb/display.pdb: added PDB function to obtain a
	window handle on an image display.

	* app/pdb/display_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpdisplay_pdb.[ch]: regenerated.

	* libgimp/gimpui.[ch]: added functions to set a GtkWindow transient
	to an image display.

	* plug-ins/common/gauss.c: use the new function exemplarily.

	* libgimp/gimp.def
	* libgimp/gimpui.def: updated.
2005-09-05 20:47:12 +00:00
Sven Neumann c482da6774 draw guides over the grid.
2005-09-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_expose): draw guides over the grid.
2005-09-02 16:26:56 +00:00
Sven Neumann 1a94b2be20 app/actions/channels-commands.c app/actions/qmask-commands.c
2005-08-23  Sven Neumann  <sven@gimp.org>

	* app/actions/channels-commands.c
	* app/actions/qmask-commands.c
	* app/dialogs/channel-options-dialog.c
	* app/dialogs/layer-options-dialog.c
	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/dialogs/resize-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/dialogs/vectors-options-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpaligntool.c
	* app/tools/gimpblendoptions.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimpstrokeeditor.c
	* libgimpwidgets/gimpcolorselection.c
	* modules/cdisplay_colorblind.c
	* modules/cdisplay_highcontrast.c
	* modules/colorsel_cmyk.c
	* plug-ins/Lighting/lighting_ui.c
	* plug-ins/common/colorify.c
	* plug-ins/common/film.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/lic.c
	* plug-ins/common/pixelize.c
	* plug-ins/common/sample_colorize.c
	* plug-ins/common/sinus.c
	* plug-ins/common/sparkle.c
	* plug-ins/gflare/gflare.c
	* plug-ins/ifscompose/ifscompose.c
	* plug-ins/imagemap/imap_cmd_guides.c
	* plug-ins/imagemap/imap_preferences.c
	* plug-ins/metadata/interface.c
	* plug-ins/print/gimp_color_window.c
	* plug-ins/print/gimp_main_window.c
	* plug-ins/rcm/rcm_dialog.c
	* plug-ins/script-fu/script-fu-server.c: applied patch from
	Stephan Binner that fixes capitalization issues (bug #309657).
2005-08-22 23:39:12 +00:00
Sven Neumann 3a83e09fa8 app/display/gimpdisplayshell-draw.c (gimp_display_shell_get_pen_gc) use
2005-08-08  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-draw.c (gimp_display_shell_get_pen_gc)
	* app/tools/gimpforegroundselecttool.c: use round joins for the
	brush strokes.
2005-08-08 00:33:51 +00:00
Sven Neumann 13b25cfbed ccorrectly handle a stroke consisting of just a single point.
2005-08-06  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_pen):
	* app/tools/gimpforegroundselecttool.c: ccorrectly handle a stroke
	consisting of just a single point.
2005-08-06 13:50:02 +00:00
Sven Neumann 769acb57b1 fixed handling of line width 2005-08-06 11:23:58 +00:00
Sven Neumann d89f04d500 app/display/gimpcanvas.c (gimp_canvas_set_custom_gc) do not drop the
2005-08-06  Sven Neumann  <sven@gimp.org>

	* app/display/gimpcanvas.c (gimp_canvas_set_custom_gc) do not
	drop the reference if the same custom GC is being set again.

	* app/display/gimpdisplayshell-draw.[ch]
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.[ch]: added GC and methods to draw
	on the canvas with a solid pen.

	* app/tools/gimpforegroundselectoptions.[ch]
	* app/tools/gimpforegroundselecttool.c: draw using the new pen
	functions. Scale the stroke width with the display scale.
2005-08-06 11:18:26 +00:00
Sven Neumann 11b6874947 app/display/gimpdisplayshell-render.c
2005-07-31  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c

	* app/display/gimpdisplayshell.[ch]: removed the overlay again.
	This needs to be done differently.

	* app/tools/gimpforegroundselecttool.c: changed accordingly.
2005-07-31 10:40:54 +00:00
Sven Neumann d53a10c004 app/display/gimpdisplayshell-render.c renamed overlay to mask and added a
2005-07-30  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell.[ch]: renamed overlay to mask and
	added a different overlay implementation that will be needed to
	finish the new foreground-select tool.

	* app/tools/gimpforegroundselecttool.c: changed accordingly.
2005-07-30 22:29:02 +00:00
Sven Neumann 1016a3dc14 app/display/gimpdisplayshell-render.c added
2005-07-30  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c
	* app/display/gimpdisplayshell.[ch]: added
	gimp_display_shell_set_overlay(); allows to overlay a mask over the
	display to visualize a selection.

	* app/tools/gimpforegroundselecttool.[ch]: use the new functionality
	to display the selection. Escape cancels the tool, Enter applies the
	selection.
2005-07-30 18:19:54 +00:00
Michael Natterer 19ea2a9db4 app/widgets/Makefile.am new files keeping the render acceleration check
2005-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimprender.[ch]: new files keeping the render
	acceleration check buffers.

	* app/display/gimpdisplayshell-render.[ch]: removed them here.

	* app/gui/gui.c: initialize/shutdown the new buffers.

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpviewrenderer.c
	* app/widgets/gimpviewrenderergradient.c
	* app/actions/view-actions.c
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c: use the new stuff. Removes
	lots of broken widgets -> display dependencies.
2005-07-19 20:42:14 +00:00
Tor Lillqvist de642dd10f Add new GimpCanvasStyle value, GIMP_CANVAS_STYLE_XOR_DOTTED.
2005-06-24  Tor Lillqvist  <tml@novell.com>

	* app/display/gimpcanvas.h: Add new GimpCanvasStyle value,
	GIMP_CANVAS_STYLE_XOR_DOTTED.

	* app/display/gimpcanvas.c (gimp_canvas_gc_new): Implement it like
	GIMP_CANVAS_STYLE_XOR_DASHED, except that we set the dash pattern
	to a single-pixel on-off one.

	* app/tools/gimpdrawtool.c (gimp_draw_tool_draw_boundary): Sort
	the boundary so that we can draw each connected group of segments
	using gimp_canvas_draw_lines(). (Even if we would still use
	gimp_canvas_draw_segments(), the boundary would have to be sorted
	so that the XOR drawing and GDK_CAP_NOT_LAST cooperate properly.)

	Use GIMP_CANVAS_STYLE_XOR_DOTTED so the outline doesn't look too
	heavy.

	Remove the dubious code snippet that offset some segments by one
	pixel. It didn't do what the comment claimed, and why one would
	need to do what the comment said, or what it actually did, is
	unclear.

	Now brush outlines shouldn't have gaps any longer. (#308710)
2005-06-24 23:28:38 +00:00
Sven Neumann f368185498 set the gravity of the image window to CENTER. Gives much better behaviour
2005-06-20  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): set the
	gravity of the image window to CENTER. Gives much better behaviour
	for "resize-windows-on-zoom".
2005-06-20 10:34:50 +00:00
Sven Neumann 03c941a9dc capitalization.
2005-06-16  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c: capitalization.
2005-06-15 22:14:47 +00:00
Michael Natterer 228762e1f2 enable ellipsation on the progressbar. Fixes initial display width
2005-05-31  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.c (gimp_statusbar_init): enable
	ellipsation on the progressbar. Fixes initial display width
	calculation for long statusbar strings.
2005-05-31 13:59:48 +00:00
Sven Neumann 93eab43eef Use the canonical form for signal names.
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names.
2005-05-27 16:51:39 +00:00
Sven Neumann 3ca90a182e Use the canonical form for signal names in lots of places (but by far not
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names in lots
	of places (but by far not all).
2005-05-27 13:05:26 +00:00
Sven Neumann 8eeb831d5f destroy the regions allocated here.
2005-05-26  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_set_highlight):
	destroy the regions allocated here.
2005-05-26 13:43:35 +00:00
Sven Neumann f54e982e82 app/display/gimpdisplayshell-appearance.c removed the 2px border and
2005-05-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell.c: removed the 2px border and
	replaced it with a 1px spacing in the main vbox. Makes the screen
	edges active when working in fullscreen mode (bug #165774).
2005-05-18 14:32:14 +00:00
Sven Neumann c671472424 app/display/gimpdisplayshell-callbacks.c hack around with gtk+ widget
2005-05-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell.c: hack around with gtk+ widget
	styles to get rid of the menubar padding in fullscreen mode.
2005-05-18 13:33:52 +00:00
Sven Neumann 5fb2c4fc86 added a read-only property to access the display-shell w/o having to
2005-05-11  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay.c: added a read-only property to access
	the display-shell w/o having to include gimpdisplay.h.
2005-05-11 20:41:51 +00:00
Sven Neumann 5c4278d003 also zoom on mouse position if the event originates from the canvas (see
2005-05-11  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c (gimp_display_shell_scale):
	also zoom on mouse position if the event originates from the canvas
	(see bug #79384).

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): replaced a g_warning()
	with g_return_if_fail().
2005-05-11 15:00:49 +00:00
Sven Neumann 7d8063dac9 return silently instead of warning if the window hasn't been realized.
2005-05-11  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_shrink_wrap):
	return silently instead of warning if the window hasn't been
	realized. This happens as part of the setup process if
	"resize-windows-on-zoom" is selected in the prefs.
2005-05-11 13:49:55 +00:00
Sven Neumann 3bb2f79984 inline tile_manager_get_tile_num().
2005-05-09  Sven Neumann  <sven@gimp.org>

	* app/base/tile-manager.c: inline tile_manager_get_tile_num().

	* app/display/gimpdisplayshell-render.c (render_image_tile_fault):
	reverted one of the changes I did here earlier.
2005-05-08 23:30:54 +00:00
Sven Neumann f3c0a28de8 abort early if the values are all setup already. Fixes bug #164281.
2005-05-06  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	(gimp_display_shell_scale_by_values): abort early if the values are
	all setup already. Fixes bug #164281.
2005-05-06 13:11:53 +00:00
Sven Neumann fedce533a2 corrected variable names.
2005-04-28  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.h: corrected variable names.
2005-04-28 14:43:11 +00:00
Sven Neumann a2428303fc fixed an oversight from yesterday's changes.
2005-04-28  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c (render_image_rgb): fixed
	an oversight from yesterday's changes.
2005-04-28 10:48:38 +00:00
Sven Neumann 5953d527df spare a few CPU cycles.
2005-04-28  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c: spare a few CPU cycles.
2005-04-27 23:27:10 +00:00
Sven Neumann 928b4f23a6 removed redundant check.
2005-04-27  Sven Neumann  <sven@gimp.org>

	* app/base/tile-manager.c (tile_manager_get_tile): removed
	redundant check.

	* app/display/gimpdisplayshell-render.c: don't access the next
	tile if we are at the end of the render loop anyway.
2005-04-27 17:53:10 +00:00
Sven Neumann 1b142e3b2a removed unused byte_order variables.
2005-04-27  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c: removed unused byte_order
	variables.
2005-04-27 17:01:56 +00:00
Sven Neumann 61d6c9353f declared the return value of gimp_image_get_colormap() as const.
2005-04-27  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-colormap.[ch]: declared the return value of
	gimp_image_get_colormap() as const.

	* app/display/gimpdisplayshell-render.c: added some const qualifiers.
2005-04-27 16:44:28 +00:00
Sven Neumann 1f137406c3 don't call gimp_display_shell_scale() if the display isn't completely
2005-04-14  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_set_property):
	don't call gimp_display_shell_scale() if the display isn't
	completely setup yet.

	* app/display/gimpdisplayshell-scale.c (gimp_display_shell_scale):
	hack around to find out whether we should pass the pointer location
	or the center of the display to gimp_display_shell_scale_to().
2005-04-14 13:01:34 +00:00
Sven Neumann 6d471b9231 center on the canvas widget, not on the display shell 2005-04-14 12:08:01 +00:00
Sven Neumann 2f753123e5 changed to use the location of the pointer instead of the display center.
2005-04-14  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c (gimp_display_shell_scale):
	changed to use the location of the pointer instead of the display
	center. This is the behaviour requested in bug #79384.
2005-04-14 11:50:23 +00:00
Sven Neumann f595dfa78e app/display/gimpdisplayshell-callbacks.c reduced code duplication.
2005-04-14  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-scale.[ch]: reduced code duplication.
2005-04-14 11:46:07 +00:00
Sven Neumann 2db22a5045 changed to keep the point under the mouse at the same location, rather
2005-04-14  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c (gimp_display_shell_scale_to):
	changed to keep the point under the mouse at the same location,
	rather than to center it. Also added API docs.
2005-04-14 11:06:49 +00:00
Sven Neumann e3d08ef79b app/display/gimpdisplayshell-callbacks.c when using Ctrl-wheel to zoom
2005-04-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-scale.[ch]: when using Ctrl-wheel
	to zoom in/out, center on the mouse position (bug #79384).
2005-04-13 16:34:53 +00:00
Michael Natterer 7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
Sven Neumann 333593daf4 changed GimpConfig utility functions to take GObject variables instead of
2005-04-07  Sven Neumann  <sven@gimp.org>

	* libgimpconfig/gimpconfig-utils.[ch]: changed GimpConfig utility
	functions to take GObject variables instead of GimpConfig. There's
	nothing GimpConfig specific about these utilities.

	* app/actions/templates-commands.c
	* app/actions/tool-options-commands.c
	* app/base/base.c
	* app/config/gimpcoreconfig.c
	* app/config/gimpdisplayconfig.c
	* app/config/gimprc.c
	* app/core/gimpimage-grid.c
	* app/core/gimpimage-new.c
	* app/core/gimpstrokedesc.c
	* app/dialogs/grid-dialog.c
	* app/dialogs/image-new-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/display/gimpdisplayshell.c
	* app/text/gimptextlayer.c
	* app/text/gimptextundo.c
	* app/tools/gimptextoptions.c
	* libgimpconfig/gimpconfig-iface.c: changed accordingly.
2005-04-07 10:05:54 +00:00
Michael Natterer ac8e7db9f2 app/dialogs/Makefile.am removed.
2005-04-05  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/info-window.[ch]: removed.

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* menus/image-menu.xml.in: removed its action and menu stuff.

	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]: removed info window stuff.
	This was the last display -> dialogs dependency.

	* app/dialogs/dialogs.c: added ugly hack that references
	info_dialog. Otherwise the still existing tools -> dialogs
	dependency breaks the build.
2005-04-04 23:48:19 +00:00
Michael Natterer 0231374c86 added new signals "sample-point-added" and "sample-point-removed" and
2005-04-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added new signals "sample-point-added"
	and "sample-point-removed" and public functions to emit them.

	* app/core/gimpimage-sample-points.c (gimp_image_add_sample_point)
	(gimp_image_remove_sample_point): emit them accordingly.

	* app/core/gimpimage-undo-push.c (undo_pop_image_sample_point):
	ditto.

	(undo_pop_image_guide)
	(undo_pop_image_sample_point): added comments why we add/remove
	stuff manually instead of using the GimpImage APIs.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcursorview.[ch]
	* app/widgets/gimpsamplepointeditor.[ch]: new widgets.
	GimpCursorView is a replacement for the info window's "Cursor"
	page, GimpSamplePointEditor is a view on an image's sample points.
	The sample point editor does nothing yet except keeping a 2x2 grid
	of GimpColorFrames. Addresses bug #137776.

	* app/dialogs/dialogs.c
	* app/dialogs/dialogs-constructors.[ch]: register the new widgets
	as dockable dialogs.

	* app/actions/dialogs-actions.c (dialogs_dockable_actions)
	* menus/dialogs-menuitems.xml: added actions and menu items for
	the new dialogs.

	* app/display/gimpdisplayshell-cursor.c
	(gimp_display_shell_update_cursor)
	(gimp_display_shell_clear_cursor): update the new cursor view.

	* app/widgets/gimphelp-ids.h: help IDs for the new dialogs.

	* app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode):
	changed description "Pixel values" to "Pixel" because the former
	was too long.
2005-04-03 15:48:03 +00:00
Sven Neumann d164aa746b do nothing if this message is at the top of the stack already.
2005-04-01  Sven Neumann  <sven@gimp.org>

	* app/display/gimpstatusbar.c (gimp_statusbar_push): do nothing if
	this message is at the top of the stack already.
2005-04-01 12:26:32 +00:00
Michael Natterer 6a35b9d161 use GTK_STOCK_DELETE for the "Don't Save" button.
2005-03-31  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): use GTK_STOCK_DELETE for the
	"Don't Save" button.
2005-03-31 00:50:13 +00:00
Sven Neumann 93a4639895 added an icon to the "Don't Save" button.
2005-03-26  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): added an icon to the "Don't Save"
	button.
2005-03-26 17:49:29 +00:00
Sven Neumann b41ee0c7ee use RINT() instead or ROUND() to get proper rounding of negative values.
2005-03-24  Sven Neumann  <sven@gimp.org>

	* app/display/gimpstatusbar.c (gimp_statusbar_push_coords)
	(gimp_statusbar_set_cursor): use RINT() instead or ROUND() to get
	proper rounding of negative values. Fixes bug #171497.
2005-03-24 17:34:13 +00:00
Sven Neumann f579c11f3b fixed gtk-doc comments; added G_GNUC_PRINTF attribute.
2005-03-23  Sven Neumann  <sven@gimp.org>

	* app/display/gimpcanvas.[ch] (gimp_canvas_draw_text): fixed
	gtk-doc comments; added G_GNUC_PRINTF attribute.
2005-03-23 13:53:31 +00:00
Michael Natterer 7cbe447c79 app/core/gimpimage-sample-points.c app/display/gimpdisplayshell-draw.c
2005-03-19  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-sample-points.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell.c
	* app/tools/gimpcolortool.c: make sure sample points always have
	coordinates in the range [0..width/height-1], also added lots of
	+0.5 because they live at the pixels' centers, not at their
	borders. Fixed drawing of sample points at the display borders.
2005-03-19 22:04:31 +00:00
Michael Natterer f41e059067 More sample point stuff. Addresses bug #137776.
2005-03-09  Michael Natterer  <mitch@gimp.org>

	More sample point stuff. Addresses bug #137776.

	* app/core/gimpimage-sample-points.c
	* app/core/gimpimage-undo-push.c: append, not prepend the sample
	paints to the image's list because their index matters. Update
	sample points when their index changes.

	* app/display/gimpcanvas.[ch]: added own sytles for the sample
	points.  Added gimp_canvas_draw_text() which uses a PangoLayout
	which is cached in the canvas.

	* app/display/gimpdisplayshell-draw.c
	(gimp_display_shell_draw_sample_point): draw the sample points
	more distinct from guides using the new canvas APIs above.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_[hv]ruler_button_press): factored out all
	code to

	(gimp_display_shell_ruler_burron_press): which takes a boolean
	"horizontal" variable and allows to add sample points with
	<control>+drag.

	* app/tools/gimpcolortool.[ch]: implement adding, moving and
	removing of sample points in the same way as the move tool moves
	guides.

	* app/tools/gimpcolorpickertool.c
	(gimp_color_picker_tool_oper_update): chain up.
2005-03-09 00:23:19 +00:00
Sven Neumann 40139ff74c added gimp_display_shell_get_unit(), for completeness.
2005-03-09  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell.[ch]: added
	gimp_display_shell_get_unit(), for completeness.
2005-03-08 23:05:58 +00:00
Michael Natterer be6a9d2a8b app/actions/view-actions.c app/actions/view-commands.[ch]
2005-03-05  Michael Natterer  <mitch@gimp.org>

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/config/gimprc-blurbs.h
	* app/core/core-enums.[ch]
	* app/core/gimp.c
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-undo-push.[ch]
	* app/core/gimpimage.c
	* app/display/gimpdisplayoptions.[ch]
	* app/display/gimpdisplayshell-appearance.[ch]
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-draw.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: reordered stuff to be in guides, grid,
	sample points order. Some cleanup and indentation.
2005-03-05 00:10:40 +00:00
William Skaggs c991c48788 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpimage.c
	* app/display/gimpdisplayoptions.c: re-order code so
	sample-point stuff comes directly after guide stuff.
2005-03-04 18:16:29 +00:00
William Skaggs ea267753f6 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpimage-sample-points.c
	* app/core/gimpimage-sample-points.h: new files

	* app/actions/view-actions.c
	* app/actions/view-commands.c
	* app/actions/view-commands.h
	* app/config/gimprc-blurbs.h
	* app/core/Makefile.am
	* app/core/core-enums.c
	* app/core/core-enums.h
	* app/core/core-types.h
	* app/core/gimp.c
	* app/core/gimp.h
	* app/core/gimpimage-crop.c
	* app/core/gimpimage-duplicate.c
	* app/core/gimpimage-flip.c
	* app/core/gimpimage-rotate.c
	* app/core/gimpimage-scale.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpimage-undo-push.h
	* app/core/gimpimage.c
	* app/core/gimpimage.h
	* app/display/gimpdisplayoptions.c
	* app/display/gimpdisplayoptions.h
	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell-appearance.h
	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-draw.h
	* app/display/gimpdisplayshell-handlers.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell.h
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: add support for a list of "sample
	points" in each image, coded and handled very similarly to
	guides, for use mainly in color correction.  See bug #137776.
2005-03-04 16:34:59 +00:00
Daniel Egger 0add60298a app/base/Makefile.am app/composite/*akefile.am app/config/*akefile.am
2005-02-27  Daniel Egger  <de@axiros.com>

	* app/base/Makefile.am
	* app/composite/*akefile.am
	* app/config/*akefile.am
	* app/core/*akefile.am
	* app/display/*akefile.am
	* app/file/*akefile.am
	* app/paint-funcs/*akefile.am
	* app/pdb/*akefile.am
	* app/plug-in/*akefile.am
	* app/text/*akefile.am
	* app/tools/*akefile.am
	* app/vectors/*akefile.am
	* app/xcf/*akefile.am: Commonized include paths to always look
	in the builddir also to cater for srcdir != builddir builds.
2005-02-27 13:22:01 +00:00
Sven Neumann b284772f77 removed redundant casts, made gimp_display_shell_compress_motion() static.
2005-02-22  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: removed redundant casts,
	made gimp_display_shell_compress_motion() static.
2005-02-22 21:38:04 +00:00
Michael Natterer 4d03c8862d app/tools/gimpmagnifytool.c (gimp_magnify_tool_init)
2005-02-22  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmagnifytool.c (gimp_magnify_tool_init)
	* app/tools/gimpmeasuretool.c (gimp_measure_tool_init)
	* app/tools/gimpvectortool.c (gimp_vector_tool_init): set
	handles_empty_image to TRUE because all these tools work fine
	without active drawable.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): also look at
	handles_empty_image, not only at gimp_image_is_empty() before
	setting the BAD cursor.
2005-02-22 12:16:23 +00:00
Michael Natterer 39fd4b3984 put back some important code that was accidentially removed when fixing
2005-02-21  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): put back some important
	code that was accidentially removed when fixing bug #162823. Also
	moved the calls to gtk_grab_add() and gtk_grab_remove() around a
	bit.
2005-02-21 18:41:05 +00:00
Sven Neumann 8ec495f481 simplified the code 2005-02-21 01:08:44 +00:00
Sven Neumann 5157dba5cb Another step towards color management:
2005-02-21  Sven Neumann  <sven@gimp.org>

	Another step towards color management:

	* modules/Makefile.am
	* modules/cdisplay_lcms.c: added new color display module that
	implements color management for the image displays. Still work
	in progress...

	* modules/cdisplay_proof.c: no need to include <string.h> here.

	* libgimpconfig/gimpcolorconfig.[ch]: added new property
	"display-module" to configure the display color management module.

	* app/display/gimpdisplayshell-filter.[ch]
	* app/display/gimpdisplayshell.c: create the configured color
	management display filter for each display.
2005-02-21 00:45:17 +00:00
Hans Breuer c6f63ea4e1 TILE_WIDTH is used unconditionally so always include "tile.h" WIN32 needs
2005-02-19  Hans Breuer  <hans@breuer.org>

	* app/base/pixel-processor.c : TILE_WIDTH is used unconditionally
	so always include "tile.h"
	* app/base/tile-swap.c : WIN32 needs <process.h> for _getpid()

	* app/dialogs/user-install-dialog.c : include gimpwin32-io.h
	* libgimpbase/gimpwin32-io.h : there are no group or other
	flags in msvcrt, define S_IGRP etc in terms of _S_IREAD etc

	* plug-ins/script-fu/script-fu.c plug-ins/script-fu/siod-wrapper.c :
	no script-fu server on win32, make respective function calls conditional

	* libgimpconfig/makefile.msc : new file
	* **/makefile.msc app/gimpcore.def : updated, gimp builds
	and runs once more with ms toolchain
2005-02-19 00:50:36 +00:00
Sven Neumann ed5e235fa6 unset the CAN_FOCUS flag on the combo boxes and the cancel button. Set
2005-02-18  Sven Neumann  <sven@gimp.org>

	* app/display/gimpstatusbar.c: unset the CAN_FOCUS flag on the
	combo boxes and the cancel button. Set "focus-on-click" to FALSE
	for the combo boxes. Fixes bug #167809.
2005-02-18 21:41:57 +00:00
Sven Neumann 9511753a02 check for gthread-2.0 unless the --disable-mp option is given.
2005-02-13  Sven Neumann  <sven@gimp.org>

	* configure.in: check for gthread-2.0 unless the --disable-mp
	option is given.

	* app/app_procs.c (app_libs_init): call g_thread_init().

	* app/base/pixel-processor.c: ported to GThread.

	* app/Makefile.am
	* app/*/Makefile.am: use @GTHREAD_CFLAGS@.
2005-02-13 15:08:08 +00:00
Sven Neumann 7c19953c39 added GimpProgress::pulse.
2005-02-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added GimpProgress::pulse.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it in the classes that
	implement the GimpProgress interface.

	* app/plug-in/plug-in-progress.[ch]: allow plug-ins to pulse their
	progress.

	* tools/pdbgen/pdb/progress.pdb: added a procedure for the new
	functionality.

	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-02-12 14:18:12 +00:00
Sven Neumann 3fef851411 app/actions/data-commands.c app/actions/edit-commands.c
2005-02-10  Sven Neumann  <sven@gimp.org>

	* app/actions/data-commands.c
	* app/actions/edit-commands.c
	* app/actions/error-console-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/gradients-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/templates-commands.c
	* app/actions/text-editor-commands.c
	* app/actions/tool-options-commands.c
	* app/dialogs/image-new-dialog.c
	* app/dialogs/resize-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-filter-dialog.c
	* app/display/gimpdisplayshell-scale.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimptexttool.c
	* libgimp/gimpexport.c
	* libgimpwidgets/gimpcolorbutton.c
	* libgimpwidgets/gimpfileentry.c
	* libgimpwidgets/gimpquerybox.c
	* libgimpwidgets/gimpunitmenu.c: applied another patch by Patrice
	Tremblay to make more dialogs obey the alternative button order
	setting (bug #166678).
2005-02-10 11:00:46 +00:00
William Skaggs a666d52d84 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events):  For testing, apply
	patch switching display-wide grab to app-wide grab while
	handling button-release event, see bug #162823.
2005-02-10 03:16:52 +00:00
Sven Neumann e21a5ff2f0 app/display/gimpscalecombobox.[ch] pass an action label to
2005-02-09  Sven Neumann  <sven@gimp.org>

	* app/display/gimpscalecombobox.[ch]
	* app/display/gimpstatusbar.c: pass an action label to
	gimp_scale_combo_box_add_action().
2005-02-09 02:33:48 +00:00
Sven Neumann 4fac6a1f6b fixed brokeness introduced by the latest changes.
2005-02-09  Sven Neumann  <sven@gimp.org>

	* app/display/gimpscalecombobox.c: fixed brokeness introduced by
	the latest changes.
2005-02-09 02:23:13 +00:00
Sven Neumann 9ee865fa20 app/display/gimpscalecombobox.[ch] add an "Other..." item to the scale
2005-02-09  Sven Neumann  <sven@gimp.org>

	* app/display/gimpscalecombobox.[ch]
	* app/display/gimpstatusbar.c: add an "Other..." item to the scale
	menu in the image window. Somewhat hackish but fixes bug #143747.
2005-02-09 02:05:03 +00:00
Michael Natterer cb7f1dbe56 removed gimp_ui_manager_ui_get() and implement the new virtual functions
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: removed gimp_ui_manager_ui_get()
	and implement the new virtual functions GtkUIManager::get_widget()
	and ::get_action() instead. Menu loading happens transparently now.

	* app/display/gimpdisplayshell.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use
	gtk_ui_manager_get_widget() instead of the removed
	gimp_ui_manager_ui_get().
2005-02-08 20:55:00 +00:00
Sven Neumann c3bb11def3 switched meaning of Ctrl and Shift modifiers used with the mouse scroll
2005-02-05  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): switched meaning of Ctrl
	and Shift modifiers used with the mouse scroll wheel. The HIG
	suggests to use Ctrl for zooming and it makes GIMP more consistent
	with other apps (for example Inkscape).
2005-02-05 20:49:28 +00:00
William Skaggs 1cee9b7298 continuing commit after broken pipe 2005-01-25 19:11:26 +00:00
Manish Singh 1960d78cce #include gimpbase.h for declaration of gimp_param_spec_unit().
2005-01-21  Manish Singh  <yosh@gimp.org>

        * app/display/gimpdisplayshell.c: #include gimpbase.h for declaration
        of gimp_param_spec_unit().
2005-01-22 02:33:29 +00:00
Sven Neumann 2750f94f28 don't use == to compare floating point values.
2005-01-19  Sven Neumann  <sven@gimp.org>

	* app/display/gimpscalecombobox.c (gimp_scale_combo_box_set_scale):
	don't use == to compare floating point values.
2005-01-18 23:30:37 +00:00
Michael Natterer 4c7e91011a added new function gimp_display_shell_dnd_init() which connects all DND
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-dnd.[ch]: added new function
	gimp_display_shell_dnd_init() which connects all DND callbacks.
	Made all DND callbacks static.

	* app/display/gimpdisplayshell.c (gimp_display_shell_init): call
	above function instead of connecting all DND callbacks here. Removed
	lots of now unused #includes.
2005-01-15 19:31:09 +00:00
Michael Natterer 7f74bdc941 app/display/gimpdisplayshell.c app/display/gimpdisplayshell-dnd.[ch]
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/widgets/gimptoolbox-dnd.c: enabled dropping of components
	to the display and the toolbox. Addresses bug #158483.
2005-01-15 17:17:33 +00:00
Sven Neumann a6ac8d2480 set the default response to Cancel in order to reduce the risk of
2005-01-04  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): set the default response to
	Cancel in order to reduce the risk of accidentally saving an
	image (bug #162872).
2005-01-04 00:14:06 +00:00
Michael Natterer 4a0b9cb662 app/actions/view-actions.c app/actions/view-commands.[ch]
2005-01-03  Michael Natterer  <mitch@gimp.org>

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/display/gimpdisplayshell-appearance.[ch]
	* menus/image-menu.xml.in: reordered actions, functions and menu
	items so the "show" and "snap" actions are grouped.
2005-01-03 16:55:24 +00:00
Michael Natterer 150bea1e80 Implemented "Snap to Canvas Edges" (fixes bug #152971) and "Snap to Active
2005-01-03  Michael Natterer  <mitch@gimp.org>

	Implemented "Snap to Canvas Edges" (fixes bug #152971) and
	"Snap to Active Path" (half way done):

	* app/core/gimpimage-snap.[ch]: added boolean snap_to_canvas and
	snap_to_vectors parameters (snap_to_vectors works fine when
	snapping to a point, but is unimplemented for snapping to a
	rectangle).

	* app/display/gimpdisplayshell.[ch] (struct GimpDisplayShell):
	added snap_to_canvas and snap_to_vectors booleans.

	* app/display/gimpdisplayshell-appearance.[ch]: added API to
	get/set them.

	* app/actions/view-actions.c
	* app/actions/view-commands.[ch]
	* app/widgets/gimphelp-ids.h: added actions, callbacks and help IDs.

	* menus/image-menu.xml.in: added them to Image->View.
2005-01-03 16:19:10 +00:00
Michael Natterer 8e1a10737b need to snap the coordinates before passing them to the active tool.
2005-01-03  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-autoscroll.c
	(gimp_display_shell_autoscroll_timeout): need to snap the
	coordinates before passing them to the active tool.
2005-01-03 15:00:55 +00:00
Sven Neumann 4e3026c637 handle event time as guint32. That's the type we deal with here and it
2005-01-03  Sven Neumann  <sven@gimp.org>

	* app/paint/gimpink.[ch]: handle event time as guint32. That's the
	type we deal with here and it avoids a crash that occured when
	autoscrolling with the Ink tool.

	* app/display/gimpdisplayshell-autoscroll.c: cosmetics.
2005-01-02 23:09:54 +00:00
Michael Natterer aef1cf9306 app/display/Makefile.am app/display/gimpdisplayshell-autoscroll.[ch] new
2005-01-02  Michael Natterer  <mitch@gimp.org>

	* app/display/Makefile.am
	* app/display/gimpdisplayshell-autoscroll.[ch]
	* app/display/gimpdisplayshell-coords.[ch]: new files factored out
	of gimpdisplayshell-callbacks.c

	* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
	"gpointer scroll_info" needed by autoscroll.

	* app/display/gimpdisplayshell-callbacks.c: removed the stuff
	above. Also removed the static autoscroll struct because it's not
	needed any longer.
2005-01-02 20:42:31 +00:00
Sven Neumann 3be2928e31 simplified code 2005-01-02 01:33:11 +00:00
Sven Neumann 3e1be87099 fixed auto-scrolling for left and bottom display edges. Remove the timeout
2005-01-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: fixed auto-scrolling
	for left and bottom display edges. Remove the timeout on
	button-release event, some minor cleanups.
2005-01-02 01:27:16 +00:00
William Skaggs 398f47529d Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/display/gimpdisplayshell-callbacks.c: use a timeout for
	autoscrolling, to fix bug #8269.  Happy new year!
2005-01-01 17:58:56 +00:00
Michael Natterer e0f25134ca Applied modified patch from Ben Campbell which adds drop coordinates to
2004-12-31  Michael Natterer  <mitch@gimp.org>

	Applied modified patch from Ben Campbell which adds drop
	coordinates to the color drop callback and uses it to insert
	colors in the palette editor. Extended the patch to add drop
	coordinates to all drop callbacks.

	* app/core/gimppalette.[ch]: added gimp_palette_insert_entry().

	* app/display/gimpdisplayshell-dnd.[ch]: added drop coordinates
	to all drop callbacks.

	* app/dialogs/palette-import-dialog.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcontainerview.c
	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpfgbgeditor.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimppropwidgets.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptooloptionseditor.c
	* libgimpwidgets/gimpcolorselect.c: changed accordingly. The passed
	drop coordiantes are so far unused.

	* app/widgets/gimppaletteeditor.c: use the drop coordinates to
	insert the new color into the palette at the right place instead
	of always appending. Fixes bug #150030.
2004-12-31 14:36:30 +00:00
William Skaggs b13aded024 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: undo changes of 12-24,
	in favor of a better fix.

	* app/widgets/gimperrordialog.c: fix bug #162147 properly,
	as suggested by mitch.
2004-12-26 17:11:31 +00:00
William Skaggs 59e86d02fb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: replace % with space
	in file name before showing error message,
	fixes bug #162147.

	* app/core/gimp-gui.c
	* app/widgets/gimpmessagebox.c: be a bit more paranoid
	about validating utf8 for messages.
2004-12-24 19:11:30 +00:00
Michael Natterer cf4a649f38 renamed gimp_ui_manager_get_action() to gimp_ui_manager_find_action().
2004-12-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: renamed
	gimp_ui_manager_get_action() to gimp_ui_manager_find_action().

	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/display/gimpdisplayshell-close.c: changed accordingly.

	(this change is quite useless as it stands, but will help keeping
	the diff between 2.2 and 2.3 small as soon as we're branched).

	* app/widgets/gimpcolormapeditor.c
	(gimp_colormap_preview_button_press): invoke the "edit-color", not
	"new-color" action upon double click.

	(palette_editor_select_entry): update the ui manager after
	selecting the entry so the entry-specific actions become sensitive
	if there was no entry selected before.
2004-12-08 13:52:28 +00:00
Michael Natterer 841efd0e2e app/display/gimpdisplayshell-appearance.c app/display/gimpdisplayshell.c
2004-12-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-appearance.c
	* app/display/gimpdisplayshell.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimptexteditor.c
	* app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
	actually returns something. Prevents crashes caused by missing
	ui manager xml files. Fixes bug #159346.
2004-12-01 00:13:48 +00:00
Hans Breuer 696663a611 [new file] app/dialogs/Makefile.am : added to EXTRA_DIST
2004-09-21  Hans Breuer  <hans@breuer.org>

	* app/dialogs/makefile.msc : [new file]
	  app/dialogs/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc app/gimpcore.def : updated

	* app/gimp.rc : let wilber be first

	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either

	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib

	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32

	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h

	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/scrip-fu.c : there
	is no script-fu-server on win32
2004-11-21 14:22:45 +00:00
Philip Lafleur 04f7c55432 Further optimization of perspective tool preview - never calculate the
2004-11-15  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-preview.c: Further optimization of
	perspective tool preview - never calculate the same vertex more
	than once.
2004-11-15 15:22:45 +00:00
Philip Lafleur 50833de419 Eliminated about 96 floating-point divides per frame in the persective
2004-11-14  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-preview.c: Eliminated about 96
	floating-point divides per frame in the persective preview.
2004-11-14 09:27:34 +00:00
Philip Lafleur c111576df2 Use the transform tool coordinates when creating subdivisions, not the
2004-11-11  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-preview.c: Use the transform
	tool coordinates when creating subdivisions, not the
	texture coordinates. Fixes breakage with layers that are not
	the image size.
2004-11-11 09:36:45 +00:00
Michael Natterer a7037f9d26 if dot_for_dot is off, resolution change has the same effect as size
2004-11-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-handlers.c
	(gimp_display_shell_resolution_changed_handler): if dot_for_dot is
	off, resolution change has the same effect as size change, so call
	gimp_display_shell_size_changed_handler(). Fixes display garbage.
2004-11-10 15:44:16 +00:00
Michael Natterer 04a7e8585b added new function gimp_statusbar_push_length(), which works exactly like
2004-11-10  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.[ch]: added new function
	gimp_statusbar_push_length(), which works exactly like
	push_coords() but takes only one value plus a GimpOrientationType
	for specifying the value's axis.

	* app/tools/gimptool.[ch]: added the corresponding
	gimp_tool_push_status_length().

	* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
	so the guide position is shown in the selected display unit.
	Cleaned up the status message code a bit.
2004-11-10 01:17:40 +00:00
Michael Natterer 6d9a69c0a6 pass (gint)-truncated coordinates instead of RINT()-rounded ones to
2004-11-09  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
	coordinates instead of RINT()-rounded ones to
	gimp_display_shell_update_cursor(). Restores correct coordinates
	display for zoomed-in display and fixes bug #153534.

	* app/tools/gimpmovetool.c: added statusbar messages including the
	(rounded) guide coordinate. Keeps bug #141719 closed.
2004-11-09 13:03:07 +00:00
Michael Natterer 9ce333eb75 don't connect to "event" and don't connect any canvas event to
2004-11-09  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): don't
	connect to "event" and don't connect any canvas event to
	gimp_display_shell_events(). Connect all tool events separately
	(doesn't include "configure-event" and thus fixes bug #141543).

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_canvas_tool_events): call
	gimp_display_shell_events() manually before doing tool event
	processing.

	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-callbacks.[ch]: connect to
	"size_allocate" of the canvas, not to "configure_event"
	(suggested by Owen in bug #141543).

	* app/display/gimpdisplayshell-callbacks.[ch]: removed
	gimp_display_shell_popup_menu().

	(gimp_display_shell_origin_button_press): emit "popup-menu" on the
	shell manually instead of calling above function.

	* app/display/gimpdisplayshell.c: added the whole menu popup code
	here.
2004-11-09 11:38:29 +00:00
Michael Natterer ba92c24d79 app/dialogs/module-dialog.c plug-ins/dbbrowser/gimpprocbrowser.c use
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/module-dialog.c
	* plug-ins/dbbrowser/gimpprocbrowser.c
	* plug-ins/dbbrowser/plugin-browser.c: use
	gtk_tree_model_get_iter_first() instead of the deprecated
	_get_iter_root().

	* app/display/gimpdisplayshell-callbacks.c: don't include
	"widgets/gimpitemfactory.h".
2004-11-03 17:13:43 +00:00
Michael Natterer c568322c43 app/display/gimpscalecombobox.c (gimp_scale_combo_box_mru_remove_last)
2004-11-03  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpscalecombobox.c
	(gimp_scale_combo_box_mru_remove_last)
	* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
	* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
2004-11-03 11:50:37 +00:00
Øyvind Kolås e4b3616a00 improve approximation of perspective tool\'s preview 2004-10-28 06:06:58 +00:00
Philip Lafleur 0b45edb7f3 Really fixed all cases of the perspective tool preview breaking with
2004-10-27  Philip Lafleur <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-preview.c: Really fixed all cases
	of the perspective tool preview breaking with certain orientations by
	using triangles instead of quads.
2004-10-28 02:32:58 +00:00
Philip Lafleur 2f3073910c Hopefully fixed all cases of the perspective tool preview breaking with
2004-10-27  Philip Lafleur <plafleur@cvs.gnome.org>

	* app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases
	of the perspective tool preview breaking with certain orientations.
2004-10-28 00:38:23 +00:00
Michael Natterer 6711646648 Don't store human readable and translatable enum/flag strings in
2004-10-25  Michael Natterer  <mitch@gimp.org>

	Don't store human readable and translatable enum/flag strings in
	GEnumValue's and GTypeValue's fields but attach them to their
	GType using separate structs and utility functions:

	* tools/gimp-mkenums: added params and perl voodoo to support
	generating a second array of values, which is used by the
	Makefiles below to create and register arrays of value
	descriptions.

	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
	arrays of translatable strings to/from enum and flags types. Added
	structs GimpEnumDesc and GimpFlagsDesc for that purpose.

	* libgimpbase/gimputils.[ch]: changed existing enum utility
	functions, added new ones and added a symmetric API for flags.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimp/Makefile.am
	* libgimpbase/Makefile.am: changed *-enums.c generation rules
	accordingly.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c
	* libgimpbase/gimpbaseenums.c: regenerated.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c
	* app/widgets/gimptemplateeditor.c
	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
	function API changes.
2004-10-25 17:55:25 +00:00
Michael Natterer e88a663631 app/actions/gradient-editor-commands.c irrelevant coding style and spacing
2004-10-25  Michael Natterer  <mitch@gimp.org>

	* app/actions/gradient-editor-commands.c
	* app/display/gimpdisplayshell-preview.c: irrelevant coding style
	and spacing cleanups.

	* app/widgets/gimpimageeditor.c: removed utility function
	gimp_image_editor_context_changed() and connect
	gimp_image_editor_set_image() directly using
	g_signal_connect_swapped().
2004-10-25 12:42:23 +00:00
Michael Natterer ea1dc9ab9f added utility function gimp_ui_manager_get_action() which takes
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpuimanager.[ch]: added utility function
	gimp_ui_manager_get_action() which takes "group_name" and
	"action_name".

	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimptooloptionseditor.c: use it.
2004-10-16 17:29:42 +00:00
Sven Neumann 0b6f4114d8 added "message" function to the GimpProgress interface. Call
2004-10-14  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added "message" function to the
	GimpProgress interface. Call gimp_message() if it is unimplemented.

	* app/plug-in/plug-in-progress.[ch]: added new function
	plug_in_progress_message() that passes the message to the current
	proc_frame's progress.

	* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
	Just do nothing in the implementation. We don't want to see
	messages from file plug-ins that we use to create the thumbnails.

	* tools/pdbgen/pdb/message.pdb
	* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
	the message by calling plug_in_progress_message().

	* app/display/gimpdisplayshell-close.c: fixed wrong types in
	function calls.
2004-10-14 15:15:03 +00:00
Sven Neumann 8300c550e3 app/widgets/Makefile.am app/widgets/widgets-types.h added a simple message
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagedialog.[ch]: added a simple message
	dialog to avoid code duplication.

	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.

	* app/dialogs/file-save-dialog.c
	* app/dialogs/quit-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 14:35:28 +00:00
Sven Neumann be8240bc53 changed button label.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): changed button label.
2004-10-13 02:29:41 +00:00
Sven Neumann 64e4c06340 changed rounding.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c: changed rounding.
2004-10-13 01:56:06 +00:00
Michael Natterer 12280a31a1 keep the container of dirty images up to date.
2004-10-13  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay-foreach.c: keep the container of dirty
	images up to date.

	* app/dialogs/quit-dialog.c: fixed model/view behavior here, too.

	(both are still far from perfect)
2004-10-13 01:39:57 +00:00
Sven Neumann e5fe5e7221 keep the time uptodate.
2004-10-13  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): keep the time uptodate.
2004-10-13 01:04:27 +00:00
Sven Neumann 92e7af4061 fixed unit handling. Right-align the labels displaying the cursor
2004-10-12  Sven Neumann  <sven@gimp.org>

	* app/dialogs/info-window.[ch]: fixed unit handling. Right-align
	the labels displaying the cursor position. Renamed the "Extended"
	tab to "Cursor". Renamed the API accordingly.

	* app/display/gimpdisplayshell-cursor.c: changed accordingly.
2004-10-12 20:14:25 +00:00
Michael Natterer fb315d6ca7 app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
	(gimp_display_shell_flush)
	* app/gui/gui-vtable.c (gui_display_create): always pass a
	GimpDisplay, not a GimpDisplayShell as "data" to
	gimp_ui_manager_update().

	* app/actions/actions.c (action_data_get_*): removed checks if the
	passed data is a GimpDisplayShell and temporarily added g_assert()
	to be sure. The assertions will be removed before 2.2.
2004-10-08 09:16:04 +00:00
Simon Budig 236cd65540 fill in the formula... :-) untabbified.
2004-10-07  Simon Budig  <simon@gimp.org>

	* app/actions/view-commands.c: fill in the formula...  :-)
	untabbified.

	* app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified.
2004-10-07 10:12:26 +00:00
Michael Natterer a1ff75dedb removed the code which sets the new image on all contexts where the old
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/actions/file-commands.c (file_revert_confirm_callback):
	removed the code which sets the new image on all contexts where
	the old image was set...

	* app/display/gimpdisplay-foreach.c (gimp_displays_reconnect):
	...and added it here so it happens for all calls of this function,
	also from the PDB. Fixes bug #154638.
2004-10-06 09:28:35 +00:00
Sven Neumann e9e2e3f65a store the time when the image is first dirtied.
2004-10-06  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage.[ch]: store the time when the image is first
	dirtied.

	* app/display/gimpdisplayshell-close.c: tell the user what time
	period of changes will be lost when the image is not saved.
2004-10-05 23:42:35 +00:00
Sven Neumann 62b5c77c76 app/config/gimpguiconfig.[ch] added gimprc option "show-help-button".
2004-10-04  Sven Neumann  <sven@gimp.org>

        * app/config/gimpguiconfig.[ch]
        * app/config/gimprc-blurbs.h: added gimprc option "show-help-button".

        * app/dialogs/preferences-dialog.c: added a GUI for it.

        * app/dialogs/file-save-dialog.c
        * app/dialogs/image-new-dialog.c
        * app/dialogs/quit-dialog.c
        * app/display/gimpdisplayshell-close.c
        * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
        dialogs.

        * libgimpbase/gimpprotocol.[ch]
        * libgimp/gimp.[ch]: added boolean "show_help_button" to the
        config message.

        * app/plug-in/plug-in-run.c: pass the new preference to the plug-in.

        * libgimpwidgets/gimpdialog.[ch]: added new function that allows to
        set whether new dialogs should get a help button added.

        * app/gui/gui.c
        * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
        to the gimprc settings.
2004-10-04 16:21:52 +00:00
Michael Natterer dbd941c9f7 dispatch GDK_Escape to GimpTool::key_press().
2004-10-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): dispatch GDK_Escape to
	GimpTool::key_press().

	* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
	* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
	cancel the tool on <Escape>.
2004-10-01 15:15:14 +00:00
Sven Neumann 297b53a466 no need to include gimpdisplayshell-render.h here.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: no need to include
	gimpdisplayshell-render.h here.

	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-render.[ch]

	* app/display/gimpdisplayshell.[ch]: added an API to highlight a
	rectangle (specified in image coordinates). Actually it doesn't
	highlight but dims the area outside the rectangle.

	* app/tools/gimpcroptool.c: use the new functionality to show the
	area to be cropped. Fixes bug #93360.
2004-10-01 09:50:04 +00:00
Michael Natterer 24f8d7e7c2 cleanup.
2004-09-27  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c: cleanup.

	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell.c
	* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.

	* app/text/gimptext-bitmap.c
	* app/text/gimptext-parasite.c
	* app/text/gimptext-vectors.c
	* app/text/gimptext-xlfd.c
	* app/text/gimptext.c
	* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
	of "text/text-types.h".

	* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
	instead of GimpDataFactoryView.

	* app/pdb/paint_tools_cmds.c: regenerated.
2004-09-27 12:30:04 +00:00
Michael Natterer b4ea222c23 Ported GimpNavigationView to use actions for its buttons:
2004-09-26  Michael Natterer  <mitch@gimp.org>

	Ported GimpNavigationView to use actions for its buttons:

	* app/menus/menus.c (menus_init): register a <GimpNaviagaionEditor>
	UI manager containing the "view" action group.

	* app/actions/actions.c (action_data_get_foo): handle "data" being
	a GimpNavigationEditor.

	* app/actions/view-actions.c (view_actions): added tooltips for
	the actions used in the editor.

	(view_actions_update): use action_data_get_display() instead of
	checking the type of "data" manually.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
	a GtkToggleButton instead of GimpButton for GtkToggleActions.

	* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
	parameter to the public constructor and removed all other
	parameters. Simplified gimp_navigation_editor_new_private() and
	use gimp_editor_add_action_button() instead of just add_button()
	for creating the buttons. Made gimp_navigation_view_set_shell()
	private. Update the UI manager when the shell zooms or scrolls.

	* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
	pass the menu_factory to gimp_navigation_editor_new().

	Removed #includes which are not needed any more.
2004-09-26 15:21:44 +00:00
Sven Neumann 5bf8abfaf5 changed mnemonic so that you can close an image w/o saving it by using
2004-09-25  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c: changed mnemonic so that
	you can close an image w/o saving it by using Ctrl-W Alt-W.
2004-09-25 17:33:30 +00:00
Michael Natterer 5aeac72ef1 added comment about not changing the silly "Qmask" string because it is
2004-09-25  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-qmask.h: added comment about not changing the
	silly "Qmask" string because it is used to identify the Quick Mask
	in the XCF.

	* app/core/gimpchannel.c: implement GimpViewable::get_description()
	and return "Quick Mask" if it's the Quick Mask.

	* app/actions/qmask-actions.c
	* app/actions/qmask-commands.c
	* app/core/core-enums.[ch]
	* app/core/gimpimage-qmask.c
	* app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/.
2004-09-25 16:52:49 +00:00
Sven Neumann 03d49fc16d resolved a mnemonics collision.
2004-09-21  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-close.c
	(gimp_display_shell_close_dialog): resolved a mnemonics collision.
2004-09-21 09:48:04 +00:00
Sven Neumann e2d8f7e48d make the "Save EXIF data" toggle insensitive when no EXIF data is present
2004-09-13  Sven Neumann  <sven@gimp.org>

	* plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data"
	toggle insensitive when no EXIF data is present (bug #140042).

	* app/display/gimpdisplayshell-close.c: as suggested by the HIG,
	ask the user to save the image when the last display is being
	closed. Addresses some issues raised in bug #106726.
2004-09-13 21:58:27 +00:00
Michael Natterer 7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Simon Budig 4a75d7271e Added boolean parameter to gimp_dialog_factories_toggle to make it
2004-09-11  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
	gimp_dialog_factories_toggle to make it possible to ensure a visible
	toolbox.

	* app/actions/dialogs-commands.c: Use the new parameter to ensure
	toolbox visibility after the last image window closes.

	* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.

	Fixes bug #137057 (the discussion is in bug #152285)
2004-09-11 19:19:26 +00:00
Michael Natterer 567385a150 #define the constant crosshair size for the INTERSECTION grid style
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-draw.c
	(gimp_display_shell_draw_grid): #define the constant crosshair
	size for the INTERSECTION grid style instead of using an eeky
	"const gint".
2004-09-07 19:08:55 +00:00
Sven Neumann 4fbc8764b4 libgimpbase/Makefile.am libgimpbase/gimpchecks.[ch] added
2004-09-03  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades().

	* app/base/temp-buf.c
	* app/display/gimpdisplayshell-render.c
	* libgimpwidgets/gimppreviewarea.c: use the new function instead
	of replicating these numbers in three different places.
2004-09-03 00:06:21 +00:00
Sven Neumann 3f4de431c1 light and dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.
2004-09-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-render.c (check_combos): light and
	dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.

	* libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and
	"check-type" properties and draw the checkerboard accordingly.
2004-09-02 15:39:07 +00:00
Sven Neumann b9bd1bfa06 app/base/base-enums.[ch] moved GimpCheckSize and GimpCheckType enums to
2004-09-02  Sven Neumann  <sven@gimp.org>

	* app/base/base-enums.[ch]
	* libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and
	GimpCheckType enums to libgimpbase. Correctly prefix the enum
	values.

	* app/base/temp-buf.c
	* app/config/gimpdisplayconfig.c
	* app/display/gimpdisplayshell-render.c
	* app/pdb/fileops_cmds.c
	* tools/pdbgen/pdb/fileops.pdb: changed accordingly.
2004-09-02 14:28:37 +00:00
Michael Natterer 2a67415c51 app/display/gimpdisplay.c gracefully handle progress calls after the
2004-09-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.c
	* app/widgets/gimpprogressdialog.c: gracefully handle progress
	calls after the widget is destroyed. Re-fixes bug #150194.
2004-09-01 15:26:48 +00:00
David Odin b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
David Odin 54fa5a0af9 eradicate some more previews in favor of views.
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
  in favor of views.
2004-08-25 17:54:12 +00:00
David Odin f168881c18 app/display/gimpnavigationview.c renamed these files to...
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...

* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
  changed GimpNavigationView to GimpNavigationEditor since it is really
  inherited from GimpEditor anyway.

This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.

* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 16:02:10 +00:00
Michael Natterer da34232a04 print bad '%' sequences literally instead of warning (g_warning() is for
2004-08-25  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): print bad '%' sequences
	literally instead of warning (g_warning() is for programming
	errors only and must never be triggered by bad or intermediate
	user input). Fixes bug #150676
2004-08-25 14:38:49 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Michael Natterer 57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Michael Natterer 502f9b71f3 app/core/gimpdrawable-blend.c some progress cleanup.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpdrawable-blend.c
	* app/core/gimpprogress.c: some progress cleanup.

	* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
	need to warn if there is already a progress active, just silently
	return NULL as all other GimpProgressInterface implementors.

	* app/plug-in/plug-in-progress.c: several progress fixes.
	It's still a mess.

	* plug-ins/common/url.c: don't show progress depending on
	run_mode. Run the actual file plug-in with the same run_mode we
	were invoked with.
2004-08-11 00:34:34 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Michael Natterer 9dc8302647 make the cursor coordinates label insensitive when displaying out-of-image
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.c: make the cursor coordinates label
	insensitive when displaying out-of-image coordinates.
2004-08-05 14:56:18 +00:00
Hans Breuer 3b3039148c build but *dont link* display-enums.obj, widget-enums.obj and
2004-07-31  Hans Breuer  <hans@breuer.org>

	* app/display/makefile.msc app/widgets/makefile.msc : build
	but *dont link* display-enums.obj, widget-enums.obj and
	gimpdisplayoptions.obj. They must be in the dll
	* app/makefile.msc : build gimp.exe and gimp-console.exe both
	using the same gimp-core.dll
	* app/gimpcore.def : new file, exports for gimp-core.dll
	* app/Makefile.am : added to EXTRA_DIST

	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
	* cursors/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc : updated

	* app/main.c app/app_procs.c : moved code to close the console
	from the former to the later. It only is to be used if The Gimp
	is not build as console app.

	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
	drawable twice
	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
	crashing on File/Import
2004-08-01 20:51:12 +00:00
Michael Natterer 4b582b481a Replaced the concept of having a boolean indicating if an undo step
2004-07-29  Michael Natterer  <mitch@gimp.org>

	Replaced the concept of having a boolean indicating if an undo
	step dirties the image by a bitfield indicating which parts
	of the image are dirtied:

	* app/core/core-enums.[ch]: reordered two values in enum
	GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.

	The values of GimpDirtyMask are still questionable and will
	probably change...

	* app/core/gimpimage.[ch]: removed signal "undo_start" and added
	a GimpDirtyMask parameter to the "dirty" and "clean" signals.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
	"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
	it to gimp_image_dirty().

	(gimp_image_undo_group_start): added *ugly* code which tries to
	figure GimpDirtyMask from the group's GimpUndoType and store it in
	the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
	gimp_image_undo_start(). This means the undo group now dirties the
	image just like one of its undo steps, but that's no problem since
	undoing cleans it in the same way.

	* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g

	(gimp_undo_pop): emit clean/dirty signals *before* performing the
	actual undo step so listeners can detach from the image before it
	is changed by undo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
	GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().

	* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
	because it makes no sense to use GimpImageMap noninteractively.
	Don't freeze()/thaw() undo while the image_map is active which
	fixes many ways of trashing the image's undo state but probably
	introduces new ways of doing evil things.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell-handlers.c: changed according
	to the GimpImage::clean()/dirty() signal changes. Small fixes
	in the quit dialog's dirty image container.

	* app/tools/gimptoolcontrol.[ch]: added member and API to
	set/get the dirty_mask.

	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: whenever setting "preserve" to
	FALSE, also set a "dirty_mask" which specifies on which image
	changes the tool wants to be canceled.

	* app/tools/tool_manager.c: removed "undo_start" connection and
	connect to both "dirty" *and* "clean" to check if the active_tool
	needs to be canceled. Cancel the tool only if the dirty_mask
	passed in the signal has common bits with the tool's dirty_mask.

	Fixes bug #109561 and probably opens some new ones...
2004-07-29 14:16:21 +00:00
Michael Natterer 69ac9e85ff Added support for motion event history as provided by some input device
2004-07-29  Michael Natterer  <mitch@gimp.org>

	Added support for motion event history as provided by some input
	device drivers. If you have a tablet driver supporting this,
	please try and report back.

	* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
	member "guint32 last_motion_time".

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): remember the last_motion_time on
	button_press() and after motion() and ask the current device for
	its motion history; in motion(), if the active_tool asks for exact
	motions, check if the input device recorded a motion history and
	process the history instead of the motion event.

	(gimp_display_shell_get_time_coords): new utility function which
	gets GimpCoords from a GdkTimeCoord struct as used by the motion
	history.
2004-07-29 13:21:55 +00:00
Michael Natterer d7a77398b9 emit "reconnect" *before* emitting scale and scroll events so listeners
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
	emit "reconnect" *before* emitting scale and scroll events so
	listeners (the navigation view) can switch to the new image at the
	right time.
2004-07-28 16:16:39 +00:00
Michael Natterer ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Michael Natterer caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Michael Natterer 3153eced5d s/pause/resume/ in the API docs.
2004-07-22  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c (gimp_display_shell_resume):
	s/pause/resume/ in the API docs.
2004-07-22 12:05:36 +00:00
Michael Natterer 9357713a2b removed GimpConfigInterface typedef, added comments to typedefs which
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/config/config-types.h: removed GimpConfigInterface typedef,
	added comments to typedefs which don't belong here.

	* app/config/gimpconfig.h: added GimpConfigInterface typedef.

	* app/core/core-types.h
	* app/display/display-types.h: added commented out typedefs for
	types that live in config-types.h for obscure reasons.

	* app/core/core-types.h: reordered stuff to match the order in the
	API docs (makes keeping stuff in sync much easier).
2004-07-19 11:33:59 +00:00
Michael Natterer 147775d63d made gtk-doc even happier; clarified meaning of the "use_offsets"
2004-07-16  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-transform.c: made gtk-doc even
	happier; clarified meaning of the "use_offsets" parameter.
2004-07-16 12:41:05 +00:00
Sven Neumann 8c4b7b5aba app/display/gimpdisplayshell.c corrected API documentation, removed
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/core/gimpdata.c:
	* app/display/gimpcanvas.c:
	* app/display/gimpdisplayshell.c
	* app/display/gimpdisplayshell-transform.c: corrected API
	documentation, removed trailing whitespace.

	Please do always build the documentation if you add or change any
	gtk-doc comments.
2004-07-16 10:07:30 +00:00
William Skaggs 0787e0304f Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/display/gimpcanvas.c:
	* app/display/gimpdisplayshell-transform.c: added gtk-doc
	comments for all public functions that lack them.

	* app/display/gimpdisplayshell.c: added a couple of
	gtk-doc comments.
2004-07-15 23:02:52 +00:00
Michael Natterer 178d7d3ff1 massively changed: removed message_ids, the message mem chunk and all
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpstatusbar.[ch]: massively changed: removed
	message_ids, the message mem chunk and all signals. Added new
	function gimp_statusbar_replace() which updates a message without
	moving it to the top of the stack. Fixes bug #120175.

	* app/display/gimpdisplayshell-title.[ch]: renamed
	gimp_display_shell_update_title() to
	gimp_display_shell_title_update() and switched from pop()/push()
	to replace() so the title message keeps its place in the stack.
	Added new function gimp_display_shell_title_init() which push()es
	the title message to the stack.

	* app/display/gimpdisplayshell.c (gimp_display_shell_new): call
	gimp_display_shell_title_init() so the "title" message is at the
	bottom of the stack.

	* app/display/gimpdisplayshell-callbacks.c
	* app/display/gimpdisplayshell-handlers.c: changed accordingly.
2004-07-14 16:37:13 +00:00
Michael Natterer fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer 2226ddf7e4 app/display/Makefile.am new files for gimp_display_shell_close() and its
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/display/Makefile.am
	* app/display/gimpdisplayshell-close.[ch]: new files for
	gimp_display_shell_close() and its dialog & callback.

	* app/display/gimpdisplayshell.[ch]: removed from here.

	* app/actions/view-actions.c (view_close_view_cmd_callback):
	changed accordingly.
2004-07-14 00:15:57 +00:00
Michael Natterer c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Michael Natterer 1175a64b3f app/config/gimpconfig-dump.c applied patch from Dave Neary which adds %B
2004-07-13  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-dump.c
	* app/display/gimpdisplayshell-title.c
	(gimp_display_shell_format_title): applied patch from Dave Neary
	which adds %B which expands to (modified) if the image is
	dirty. Also added %A which expands to (clean) because we also have
	a short indicator for the clean image. Fixes bug #130943.
2004-07-12 23:36:45 +00:00
Michael Natterer 87c1722700 added an "id" CONSTRUCT_ONLY property. Some minor cleanup.
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
	property. Some minor cleanup.
2004-07-12 11:43:00 +00:00
Sven Neumann 95e7d5ee0a removed images from the container when they become clean. Should move to
2004-07-12  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay-foreach.c
	(gimp_displays_get_dirty_images): removed images from the
	container when they become clean. Should move to the Gimp object.

	* app/gui/quit-dialog.c: some cosmetic changes.
2004-07-12 11:12:19 +00:00
Hans Breuer b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Sven Neumann e730bbb1f2 added new function gimp_displays_get_dirty_images().
2004-07-10  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplay-foreach.[ch]: added new function
	gimp_displays_get_dirty_images().

	* app/gui/quit-dialog.c: show a container treview of all dirty
	images in the quit dialog. Still work in progress...
2004-07-09 22:28:27 +00:00
Michael Natterer a31bbed6c7 #define MIN and MAX values for GimpCoords.pressure, .tilt and .wheel.
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/core/core-types.h: #define MIN and MAX values for
	GimpCoords.pressure, .tilt and .wheel.

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_get_event_coords)
	(gimp_display_shell_get_device_coords): use the #defines instead
	of hardcoded magic values when CLAMP()ing event or device values.
2004-07-05 18:48:43 +00:00
Simon Budig e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00