Commit Graph

1941 Commits

Author SHA1 Message Date
Sven Neumann f4b3d0918e added a label that shows the pixel size (as in the initial mockup done by
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimptemplateeditor.[ch]: added a label that shows
	the pixel size (as in the initial mockup done by Jimmac).
2004-09-24 14:43:32 +00:00
Michael Natterer ee5354e4b7 app/dialogs/Makefile.am removed...
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/Makefile.am
	* app/dialogs/color-dialog.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.

	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.

	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.

	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* app/actions/gradient-editor-commands.c
	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 20:41:40 +00:00
Michael Natterer 9ffc00be80 app/plug-in/Makefile.am removed... ...and added with a new name.
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-proc.[ch]: removed...
	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.[ch]
	* app/plug-in/plug-in-progress.[ch]
	* app/plug-in/plug-in-rc.[ch]
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.[ch]
	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
	minor cosmetic cleanups.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 15:12:24 +00:00
Michael Natterer 10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
Sven Neumann e0d0d7cff1 removed the prelit event box from the header frame, use a smaller font for
2004-09-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpviewabledialog.c: removed the prelit event box
	from the header frame, use a smaller font for the subtitle,
	removed the separator.

	* app/dialogs/preferences-dialog.c: removed the prelit event box
	from the header frame. Perhaps we should have subtitles here with
	a more verbose description of the settings page?
2004-09-21 22:31:20 +00:00
Michael Natterer 37912655f2 For the sake of completeness, added a GUI for the hidden "Open as Layer"
2004-09-21  Michael Natterer  <mitch@gimp.org>

	For the sake of completeness, added a GUI for the hidden
	"Open as Layer" feature:

	* app/actions/file-actions.c
	* app/actions/file-commands.[ch]: added "file-open-as-layer"
	action and callback. Abuse the "gimage" field of GimpFileDialog to
	indicate layer opening (it's otherwise unused for file-open).

	* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
	open the selected files as layers for that image.

	* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.

	* menus/image-menu.xml.in: added it to the menu.
2004-09-21 12:08:30 +00:00
Sven Neumann 69c5ce557d fixed handling of too many error messages.
2004-09-19  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
	handling of too many error messages.
2004-09-19 17:10:53 +00:00
Sven Neumann c3ef897b10 Try to make floating selections more obvious:
2004-09-19  Sven Neumann  <sven@gimp.org>

	Try to make floating selections more obvious:

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): always display
	"Floating Selection" as the name for a floating selection.

	* app/core/gimpselection.c (gimp_selection_float): call the new
	layer "Selection" instead of "Floating Selection". This is what
	will be displayed if the FS is turned into a layer.

	* app/actions/layers-commands.c (layers_edit_layer_query): don't
	special case floating selections here.

	* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 16:56:03 +00:00
Michael Natterer c9cac47fbe use gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.c
	(gimp_component_editor_renderer_update): use
	gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17 11:20:30 +00:00
Simon Budig 430c5f8170 Added a slider for the brush spacing to the brush editor. Should make it
2004-09-17  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
	brush spacing to the brush editor. Should make it more obvious
	how to change it.
2004-09-17 10:31:34 +00:00
Michael Natterer 357dc2d777 depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.

	* app/gui/gui.c: changed accordingly.

	* app/sanity.c: ditto. Added check for GLib and put each check
	into its own utility function. Enabled #if 0'ed check for
	FreeType >= 6.2.7.

	* app/widgets/gimpactiongroup.c
	* app/widgets/gimpcursor.c
	* app/widgets/gimpselectiondata.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpwidgets-utils.c: removed workarounds for library
	versions we refuse to start with.
2004-09-16 14:31:39 +00:00
Michael Natterer f338d93835 reverse order of DND dests so "text/uri-list" is preferred again after my
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
	order of DND dests so "text/uri-list" is preferred again after my
	DND change of 2004-06-29. Fixes dropping of multiple files.
2004-09-16 14:28:10 +00:00
Michael Natterer 0514ee4ba2 set the viewable renderer's "renderer" property to NULL when clearing the
2004-09-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcomponenteditor.[ch]: set the viewable
	renderer's "renderer" property to NULL when clearing the
	view to work around bug #149906.
2004-09-16 14:00:02 +00:00
Michael Natterer 186b590844 added help IDs for the drawable- and vectors-visible and -liked actions as
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
	vectors-visible and -liked actions as well as for the layer mask
	property action.

	* app/actions/drawable-actions.c
	* app/actions/vectors-actions.c: use them.

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: ditto. Use
	GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
	"paint_mode" by "mode" in all action and function/variable names
	because this is the layer mode, not a paint mode.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/vectors-commands.c: set the "activates-default"
	property on the name entry in all "New Foo" and "Edit Foo
	Attributes" dialogs except in the "New Layer" dialog.
	Addresses bug #148026.

	* menus/image-menu.xml.in: added a (commented out) layer
	properties menu containing all the new actions.
2004-09-15 15:06:08 +00:00
Michael Natterer 6a723efc4b app/actions/layers-actions.c added actions and callbacks
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added actions and callbacks
	"layers-preserve-transparency" and
	"layers-paint-mode-first,last,previous,next". Update the "active"
	state of the recently added layer mask property actions in
	layers_actions_update().

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: added actions and callbacks
	for "drawable-visible" and "drawable-linked". Fixes bug #152597.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
	and "vectors-linked").

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_preserve_button_toggled): flush the image
	so the new actions are updated. Compress preserve_trans undos.

	* menus/image-menu.xml.in: added the layer mask property actions
	to the Layers/Mask submenu.

	* menus/layers-menu.xml: reordered the mask property actions
	to have the same order as in the image menu.
2004-09-15 13:24:45 +00:00
Sven Neumann b5f8fa24d8 improved the fix for bug #152662 and removed trailing whitespace.
2004-09-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_menu_position): improved the fix for bug
	#152662 and removed trailing whitespace.
2004-09-15 09:34:02 +00:00
Nathan Summers 8c4062f2b2 clamp the popup menu's Y position to the visible area of the GtkTreeView.
2004-09-15  Nathan Summers  <rock@gimp.org>

        * app/widgets/gimpcontainertreeview.c
        (gimp_container_tree_view_menu_position): clamp the popup menu's Y
        position to the visible area of the GtkTreeView.  Fixes #152662.
2004-09-15 05:55:56 +00:00
Michael Natterer d62a3f0487 simplified the code which deals with the global_buffer's preview. The new
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.c: simplified the code which deals
	with the global_buffer's preview. The new buffer view renderer
	does the aspect ratio magic all by itself now.

	* app/actions/image-commands.h: removed trailing whitespace.
2004-09-14 12:19:16 +00:00
Michael Natterer c450ca1858 app/widgets/Makefile.am app/widgets/widgets-types.h added a view renderer
2004-09-14  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
	which knows how to preserve a GimpBuffer's aspect ratio if the
	view's aspect ratio is different.

	* app/widgets/gimpviewrenderer-utils.c
	(gimp_view_renderer_type_from_viewable_type): use it for viewables
	of type GimpBuffer. Fixes bug #152531
2004-09-14 12:06:28 +00:00
Michael Natterer 7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Sven Neumann 952cd37e00 simulate the behaviour of GNU gettext and look at the LANGUAGE environment
2004-09-13  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
	look at the LANGUAGE environment variable if the locale is not "C".
2004-09-13 12:19:34 +00:00
Simon Budig 4a75d7271e Added boolean parameter to gimp_dialog_factories_toggle to make it
2004-09-11  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
	gimp_dialog_factories_toggle to make it possible to ensure a visible
	toolbox.

	* app/actions/dialogs-commands.c: Use the new parameter to ensure
	toolbox visibility after the last image window closes.

	* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.

	Fixes bug #137057 (the discussion is in bug #152285)
2004-09-11 19:19:26 +00:00
William Skaggs fe876df0ed Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimperrorconsole.c: fix typo
2004-09-10 15:38:17 +00:00
Michael Natterer 4b553f186c always call gdk_drag_status() before returning FALSE.
2004-09-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c
	(gimp_container_tree_view_drop_status): always call
	gdk_drag_status() before returning FALSE.

	(gimp_container_tree_view_drag_motion): never return FALSE, an
	impossible drop location is now reported by calling
	gdk_drag_status() above. Always returning TRUE makes sure
	gimp_container_tree_view_drag_leave() is called unconditionally
	and can remove the scroll_timeout set in drag_motion().

	Fixes bug #152193 and many other obscure DND crashes caused by the
	scroll_timeout being invoked after the widget is destroyed.
2004-09-10 12:20:16 +00:00
Michael Natterer fa3f37e96e app/widgets/gimpviewrendererbrush.c app/widgets/gimpviewrendererdrawable.c
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* app/widgets/gimpviewrendererimagefile.c
	* app/widgets/gimpviewrendererlayer.c
	* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
2004-09-09 11:58:49 +00:00
Michael Natterer d7fc14fbc8 use g_type_name(dialog_type) instead of just "pdb dialog" as name for the
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
	g_type_name(dialog_type) instead of just "pdb dialog" as name for
	the dialog's private context.
2004-09-09 11:48:45 +00:00
Michael Natterer abf395c0cd renamed parameter "gboolean raise_if_found" to "return_existing" and added
2004-09-09  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factory_dialog_new_internal): renamed parameter
	"gboolean raise_if_found" to "return_existing" and added
	additional parameter "gboolean present".

	(gimp_dialog_factory_dialog_new)
	(gimp_dialog_factory_dialog_raise)
	(gimp_dialog_factory_dockable_new): pass both parameters (passing
	"present" as "raise_if_found" was not quite correct).
2004-09-09 09:02:26 +00:00
Michael Natterer d8a3c0c08c simplified the code that selects an image file by its URI.
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
	simplified the code that selects an image file by its URI.
2004-09-07 10:45:36 +00:00
Simon Budig 20504d16a9 Added an indicator for generated brushes. Pretty straightforward,
2004-09-07  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpviewrendererbrush.c: Added an indicator for
	generated brushes. Pretty straightforward, suggestions for
	improvements are welcome.
2004-09-06 23:55:24 +00:00
Sven Neumann 4bfbd2c5c3 bumped version number to 2.1.5.
2004-09-05  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 2.1.5.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
	the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 20:17:53 +00:00
Simon Budig fe7eb34e6e Implement function to resize the image to contain all layers completely.
2004-09-05  Simon Budig  <simon@gimp.org>

	* app/core/gimpimage-resize.[ch]: Implement function to resize
	the image to contain all layers completely. Untabified.

	* app/actions/image-actions.c
	* app/actions/image-commands.[ch]
	* app/widgets/gimphelp-ids.h
	* menus/image-menu.xml.in: Make it available in the GUI.

	* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.

	* app/pdb/image_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpimage_pdb.[ch]: regenerated.
2004-09-04 22:08:43 +00:00
Michael Natterer 1c045ca77e removed "Configure input devices" button. Fixes bug #150177.
2004-09-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdevicestatus.c: removed "Configure input
	devices" button. Fixes bug #150177.
2004-09-03 14:26:50 +00:00
Michael Natterer 2a67415c51 app/display/gimpdisplay.c gracefully handle progress calls after the
2004-09-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplay.c
	* app/widgets/gimpprogressdialog.c: gracefully handle progress
	calls after the widget is destroyed. Re-fixes bug #150194.
2004-09-01 15:26:48 +00:00
Sven Neumann ce1370bb2e added a boolean parameter to gimp_dialog_factory_dialog_new() to let the
2004-09-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
	gimp_dialog_factory_dialog_new() to let the caller decide whether
	the window should be presented or not.

	* app/actions/dialogs-commands.c
	* app/actions/image-commands.c
	* app/actions/templates-commands.c
	* app/gui/gui-vtable.c
	* app/gui/gui.c
	* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
	gimp_dialog_factory_dialog_new() present the dialog if we need to
	change it after creation. This avoids annoying resizes, noticeable
	especially with the error dialog.
2004-08-31 22:41:15 +00:00
Sven Neumann cd4154e142 app/widgets/gimpdockable.c converted tabs to spaces.
2004-08-31  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpdockable.c
	* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
2004-08-31 21:29:30 +00:00
Michael Natterer a3bb332214 emit "clicked" on the edit_button only if it exists and is sensitive.
2004-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdatafactoryview.c
	(gimp_data_factory_view_activate_item): emit "clicked" on the
	edit_button only if it exists and is sensitive. Fixes bug #151343.
2004-08-31 21:07:35 +00:00
David Odin b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
Sven Neumann 7e9f0d4a71 applied a patch from Joao S. O. Bueno which adds an API that allows to
2004-08-28  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
	S. O. Bueno which adds an API that allows to make the scale widget
	of a GimpScaleEntry behave logarithmic. Fixes bug #149420.

	* app/widgets/gimpbrusheditor.c: use the new functionality for the
	radius control.
2004-08-28 16:57:37 +00:00
Sven Neumann 52bf83ee69 app/widgets/gimphelp-ids.h added a help-id for the image area.
2004-08-28  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h
	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
	help-id for the image area.
2004-08-28 10:57:24 +00:00
Michael Natterer 28e1f2a9da call gimp_container_editor_select_item() manually at construction time so
2004-08-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_construct): call
	gimp_container_editor_select_item() manually at construction time
	so views show the initially selected object's state correctly
	(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 17:38:57 +00:00
David Odin ec4cc4f897 app/widgets/gimpnavigationpreview.c renamed these files to ...
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...

* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
  And renamed the GimpNavigationPreview type to GimpNavigationView.

Hopefully, this is the last change in file names for the Preview->View
renaming process.

* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-27 00:42:46 +00:00
David Odin 5af63086ba GimpViewRendererVector is really derived from GimpViewRenderer and not
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
  really derived from GimpViewRenderer and not from GimpViewRendererDrawable.
2004-08-26 14:59:31 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
David Odin d93b26e7fa app/widgets/gimppreview-popup.c app/widgets/gimppreview-popup.h
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
2004-08-26 00:50:45 +00:00
David Odin e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
Sven Neumann 8b6970ec28 stop adding message boxes and redirect messages to stderr if there are too
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
	adding message boxes and redirect messages to stderr if there are
	too many messages.
2004-08-25 19:49:50 +00:00
Sven Neumann 80531ec936 added gimp_message_box_repeat().
2004-08-25  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
	GimpMessageBox for each message added. Fixes bug #92604.

	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
	functionality.

	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.

	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.

	* app/gui/gui-vtable.c (gui_message): use the new error dialog.

	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
	domain.

	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
	when being called with a NULL domain.
2004-08-25 17:58:52 +00:00
Sven Neumann d52d54fe9d put the icon to the right for RTL layouts.
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
	layouts.

	* app/display/gimpdisplayshell-close.c
	* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 21:42:29 +00:00
Sven Neumann 6939d7ab90 added API to change the labels. Modeled after the proposed new API for
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
	Modeled after the proposed new API for GtkMessageDialog.

	* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 20:08:33 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
Sven Neumann 578bd328e0 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget
2004-08-24  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.

	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 23:22:46 +00:00
Sven Neumann 509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
Sven Neumann c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
Manish Singh 83a94230ed app/widgets/gimpcellrendereraccel.c app/widgets/gimphistogrambox.c Get rid
2004-08-18  Manish Singh  <yosh@gimp.org>

        * app/widgets/gimpcellrendereraccel.c
        * app/widgets/gimphistogrambox.c
        * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-19 00:21:55 +00:00
Sven Neumann 0620ee069e no need to set a size_request here.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/gui/color-notebook.c: no need to set a size_request here.

	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.

	* libgimpwidgets/gimpcolorscales.c
	* modules/colorsel_cmyk.c: don't set a minimum width on the color
	scales. Improves behaviour for narrow color dockables.
2004-08-18 21:50:26 +00:00
Sven Neumann 2d5ee4485d define GIMP_HELP_DOCK_SEPARATOR.
2004-08-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.

	* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: help-ids are never used directly,
	use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-18 09:53:38 +00:00
William Skaggs 8e36dd8ffb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
	* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 17:46:48 +00:00
Sven Neumann 6543cfde20 fixed labels in CMYK mode. Fixes bug #150213.
2004-08-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
	labels in CMYK mode. Fixes bug #150213.
2004-08-16 07:24:42 +00:00
Michael Natterer 1437f52d63 make sure that all actions, even if they have no menu proxy, can be
2004-08-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
	make sure that all actions, even if they have no menu proxy, can
	be invoked by their accelerators. Fixes bug #149938.

	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
	removed the same code here.

	* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
	function which disconnects from "accel_changed" of the accel_group
	before upchaining (== before emitting "destroy").

	The above changes make this one redundant, but since the crash in
	bug #149938 was triggered by "accel_changed" emitted in the middle
	of g_object_unref(tree_model), it feels better to be paranoic here
	(fiddling with objects in destruction is no fun).

	(gimp_action_view_accel_edited): don't warn if assigning the same
	accel to the same action again.

	(gimp_action_view_new): don't leak all accel_closures.
2004-08-12 20:04:19 +00:00
Michael Natterer a8e599ebbf app/widgets/gimpcontainercombobox.[ch] when removing the last item from
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainertreeview.c: when removing the last item
	from the view, manually clear all GimpCellRendererViewables'
	"renderer" properties; otherwise we have stale GimpPreviewRenderers
	with still-refed viewables hanging around in the cells.
	Works around GTK+ bug #149906.
2004-08-11 14:07:35 +00:00
Michael Natterer 57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
Sven Neumann 846bacd905 app/gui/file-open-location-dialog.c increased horizontal size request to
2004-08-11  Sven Neumann  <sven@gimp.org>

	* app/gui/file-open-location-dialog.c
	* app/widgets/gimpprogressbox.c: increased horizontal size request
	to reduce resizing.
2004-08-10 23:37:06 +00:00
Michael Natterer 828b852e06 fixed annoying resizing when thumbnailing exactly one image.
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
	fixed annoying resizing when thumbnailing exactly one image.
2004-08-10 22:34:45 +00:00
Michael Natterer 06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
Michael Natterer 95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Hans Breuer eafd79de87 gimp_create_display() with the right parameters order
2004-08-09  Hans Breuer  <hans@breuer.org>

	* app/core/gimp-edit.c(gimp_edit_paste_as_new) :
	gimp_create_display() with the right parameters order

	* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
	handle gtk_style_lookup_icon_set() returnig NULL

	* app/gimpcore.def app/widgets/makefile.msc
	  themes/default/images/makefile.msc : updated
2004-08-08 22:47:23 +00:00
Michael Natterer 60fd11d79b Enabled previewing items without selecting them in all list and grid views
2004-08-05  Michael Natterer  <mitch@gimp.org>

	Enabled previewing items without selecting them in all list and
	grid views using mouse button 2. Implicitly enables previewing of
	items in container popups and thus fixes bug #121011:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event)
	* app/widgets/gimpcellrendererviewable.c
	(gimp_cell_renderer_viewable_clicked): show the preview also on
	mouse button 2 click.

	* app/widgets/gimpcontainertreeview.c
	(gimp_container_tree_view_button_press): dispatch mouse button 2
	clicks to GimpCellRendererViewable, but don't select or change
	anything in the tree_view.

	Unrelated cleanup:

	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
	don't offset bevent->x,y by widget->allocation.x,y before calling
	gimp_preview_popup_show() ...

	* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
	... instead, do it here generically (check if the parent widget is
	GTK_WIDGET_NO_WINDOW()).
2004-08-05 13:43:38 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer fd1a0e142c Allow URI drops from apps linked against GLib < 2.4.4 to GIMP linked
2004-08-04  Michael Natterer  <mitch@gimp.org>

	Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
	linked against GLib >= 2.4.5. Fixes bug #148140.

	* app/core/gimp-utils.[ch]: added gimp_check_glib_version().

	* app/widgets/gimpselectiondata.c: added runtime check for GLib
	versions that encode file:// URIs correctly (>= 2.4.5). For older
	(broken) GLibs, leave the code path as is, for newer (fixed) ones,
	perform an additional check if the dropped URI is in the (broken)
	escaped-UTF-8 format and convert it to local filename encoding.

	* app/gui/gui.c: warn the user that non-ASCII filenames can't
	be used when linked against GLib 2.4.4.
2004-08-04 17:11:39 +00:00
Michael Natterer 0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
Michael Natterer 8260cd69ce ref/unref the view around the calls to gimp_container_view_item_selected()
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainergridview.c
	(gimp_container_grid_view_item_context): ref/unref the view around
	the calls to gimp_container_view_item_selected() and _item_context()
	because the former may destroy the view which leads to a crash
	when trying the latter. Fixes bug #148955.
2004-08-03 14:55:31 +00:00
Michael Natterer b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Hans Breuer 3b3039148c build but *dont link* display-enums.obj, widget-enums.obj and
2004-07-31  Hans Breuer  <hans@breuer.org>

	* app/display/makefile.msc app/widgets/makefile.msc : build
	but *dont link* display-enums.obj, widget-enums.obj and
	gimpdisplayoptions.obj. They must be in the dll
	* app/makefile.msc : build gimp.exe and gimp-console.exe both
	using the same gimp-core.dll
	* app/gimpcore.def : new file, exports for gimp-core.dll
	* app/Makefile.am : added to EXTRA_DIST

	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
	* cursors/Makefile.am : added to EXTRA_DIST

	* **/makefile.msc : updated

	* app/main.c app/app_procs.c : moved code to close the console
	from the former to the later. It only is to be used if The Gimp
	is not build as console app.

	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
	drawable twice
	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
	crashing on File/Import
2004-08-01 20:51:12 +00:00
Simon Budig b05f9f4b60 Fixed oversight that accidentially reset the number of spikes to 2.
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
	reset the number of spikes to 2.
2004-08-01 18:09:41 +00:00
Simon Budig 1eb3009f1a Added optional spikes for the generated brushes, enabling star shaped
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
	the generated brushes, enabling star shaped generated brushes.

	* app/widgets/gimpbrusheditor.[ch]: GUI for this.

	* app/core/gimpbrush.c: changed accordingly.
2004-08-01 17:20:00 +00:00
Simon Budig c40e29399d app/core/core-enums.h Implement three different brush shapes for generated
2004-08-01  Simon Budig  <simon@gimp.org>

	* app/core/core-enums.h
	* app/core/gimpbrushgenerated.[ch]: Implement three different
	brush shapes for generated brushes.

	* app/core/gimpbrush.c: changed accordingly.
	* app/core/core-enums.c: regenerated.

	* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
	* themes/Default/images/stock-brush-generated-*-16.png: New stock
	icons for the brush shapes.

	* themes/Default/images/Makefile.am
	* libgimpwidgets/gimpstock.[ch]: changed accordingly

	untabified the files touched.
2004-08-01 03:06:58 +00:00
Sven Neumann 26a4b20dfe always do the check for perl and use the substituted perl executable name
2004-07-30  Sven Neumann  <sven@gimp.org>

	* configure.in: always do the check for perl and use the
	substituted perl executable name in the call for gimp-mkenums.
	Fixes the build on platforms where perl is not available as
	/usr/bin/perl. Closes bug #148813.

	* app/widgets/gimpenumstore.c: added missing include.
2004-07-30 20:42:53 +00:00
Sven Neumann c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Sven Neumann e10ebe1805 removed enums GimpImageType and GimpImageBaseType ...
2004-07-29  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.h: removed enums GimpImageType and
	GimpImageBaseType ...

	* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
	all enums from gimpbasetypes.h to this new file.

	* libgimpbase/Makefile.am
	* tools/pdbgen/Makefile.am: changed accordingly.

	* app/core/core-enums.c
	* libgimp/gimpenums.h
	* libgimpbase/gimpbaseenums.c
	* tools/pdbgen/enums.pl: regenerated.

	* libgimpbase/gimpparasite.c
	* libgimpbase/gimpprotocol.c
	* libgimp/gimp.c: include <glib-object.h>

	* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
	translation domain on a GType. This is used for translatable enum
	values.

	* libgimpbase/gimputils.[ch]: added API to retrieve the translated
	name for an enum value.

	* app/widgets/gimpenumstore.c
	* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
2004-07-29 12:33:15 +00:00
Michael Natterer ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Michael Natterer 9a153f6e58 forgot to strip mnemonics here.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactiongroup.c
	(gimp_action_group_set_action_label): forgot to strip mnemonics
	here.
2004-07-27 22:38:40 +00:00
Michael Natterer 210ef45abb Enabled disabling all menu mnemonics. Addresses bug #120034:
2004-07-28  Michael Natterer  <mitch@gimp.org>

	Enabled disabling all menu mnemonics. Addresses bug #120034:

	* app/config/gimpguiconfig.[ch]
	* app/config/gimprc-blurbs.h: added boolean RESTART property
	"menu-menonics".

	* app/gui/preferences-dialog.c: added a GUI for it.

	* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
	property "mnemonics".

	(gimp_action_group_add_*_actions): call gimp_strip_uline() on
	the actions' labels if mnemonics is FALSE.

	* app/widgets/gimpactionfactory.[ch]
	* app/actions/actions.c: pass gui_config->menu_menmonics to
	all action groups.
2004-07-27 22:17:30 +00:00
Sven Neumann bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Sven Neumann 7e3e851c63 string change.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
2004-07-27 12:41:44 +00:00
Michael Natterer a66a3b47c9 make sure we always set a non-null URI.
2004-07-27  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
	sure we always set a non-null URI.
2004-07-27 12:39:56 +00:00
Sven Neumann 67ff4473a2 app/widgets/gimphelp-ids.h removed unused help IDs GIMP_HELP_FILE_OPEN_XCF
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp-ids.h removed unused help IDs
	GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
	for these entries are generated from the procedure names.
2004-07-27 12:28:30 +00:00
Sven Neumann 228aadc25c print the help-id and help-domain to stdout if gimp was started with the
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphelp.c (gimp_help): print the help-id and
	help-domain to stdout if gimp was started with the --verbose
	command-line option.
2004-07-27 11:19:33 +00:00
Sven Neumann a1ac37ed19 show extensions in the filters menu.
2004-07-27  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	show extensions in the filters menu.
2004-07-27 00:26:14 +00:00
Sven Neumann 744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
Michael Natterer a2b85a62b0 new function which clears the whole list of data set by plug-ins.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
	function which clears the whole list of data set by plug-ins.

	(procedural_db_free): use it.

	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.[ch]: added action, callback and
	confirmation dialog for "Reset all filters to default values".
	Somehow addresses bug #81015.

	* app/widgets/gimphelp-ids.h: added a help ID for the new action.

	* menus/image-menu.xml.in: added it to the "Filters" submenu.
2004-07-26 21:07:15 +00:00
Michael Natterer caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00
Sven Neumann b50ea15b26 rephrased the text for the dialog that appears if a new shortcut collides
2004-07-22  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpactionview.c: rephrased the text for the dialog
	that appears if a new shortcut collides with an existing one.

	* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
	which accepts RGB colors in hexadezimal notation or as SVG color
	keywords.
2004-07-22 12:42:57 +00:00
Michael Natterer a5760e33fe connect to "accel-changed" of the accel_group using connect_object(), not
2004-07-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
	"accel-changed" of the accel_group using connect_object(), not
	just connect() so we don't crash when it's emitted after the
	toolbox is destroyed.
2004-07-22 11:18:52 +00:00
Michael Natterer a80977b0bc app/widgets/gimptemplateeditor.c plug-ins/common/gif.c set GTK_SHADOW_IN
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateeditor.c
	* plug-ins/common/gif.c
	* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
	text views. Fixes bug #148025.
2004-07-21 16:29:29 +00:00
Michael Natterer cc6288a4fb Enabled the various "Clear saved foobar now" buttons in prefs:
2004-07-21  Michael Natterer  <mitch@gimp.org>

	Enabled the various "Clear saved foobar now" buttons in prefs:

	* app/gui/session.[ch]
	* app/menus/menus.[ch]
	* app/widgets/gimpdevices.[ch]: implemented the _clear()
	functions: unlink() the rc file and set an internal flag that it
	has been deleted. Added "gboolean always_save" parameter to the
	_save() functions and don't save anything if it is FALSE and the
	internal deletion flag has been set.

	* app/gui/gui.c
	* app/widgets/gimpdevicestatus.c: changed accordingly.

	* app/gui/preferences-dialog.c: added callbacks for all "Save now"
	and "Clear now" buttons and show error messages if clearing fails.
	Inform the user that she has to restart GIMP to see the effect of
	the clearing.
2004-07-21 16:11:31 +00:00
Michael Natterer e7479951b5 app/core/gimpmarshal.list added "gboolean delete" parameter to the
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
	parameter to the GimpCellRendererAccel::accel_edited() signal.

	* app/widgets/gimpactionview.c: distinguish between deletion of an
	accelerator and the user entering an invalid accelerator.
2004-07-21 14:09:36 +00:00
Michael Natterer b241a40b43 remember the keyboard shortcut dialog and show it only once.
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/gui/preferences-dialog.c: remember the keyboard shortcut
	dialog and show it only once.

	* app/widgets/gimpactionview.c
	* app/widgets/gimpcellrendereraccel.c: minor cleanups.

	Seems to work pretty well now and thus fixes bug #142922.
2004-07-21 11:28:31 +00:00
Michael Natterer 62bf62a151 app/core/gimpmarshal.list app/widgets/Makefile.am
2004-07-21  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpmarshal.list
	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
	which displays an accelerator and allows to edit it (ripped
	out of libegg and modified).

	* app/widgets/gimpactionview.c: use the new renderer and connect
	to its "accel-edited" signal (its callback is one huge mess that
	needs to be cleaned up). Added ugly hack to work around GTK+ API
	limitation that seems to prevent implementing a shortcut editor in
	a sane way.

	* app/actions/file-actions.c
	* app/actions/image-actions.c
	* app/actions/tools-actions.c: added ugly hacks here, too.

	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
	editor by Close.
2004-07-21 00:39:46 +00:00
Michael Natterer 94fc8f15a1 app/widgets/gimpactionfactory.[ch] added "label" and "stock-id" properties
2004-07-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpactionfactory.[ch]
	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
	properties to GtkActionGroup and allow to register them in the
	GimpActionFactory.

	* app/actions/actions.c: register user visible labels and icons
	with all action groups.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpactionview.[ch]: new widget which shows a
	treeview of action groups and their actions & shortcuts.

	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
	utility function.

	* app/widgets/gimpwidgets-utils.[ch]: added
	gimp_get_accel_string() utility function.

	* app/widgets/gimpcontrollers.[ch]: added
	gimp_controllers_get_ui_manager() which will be used for setting
	up the controller mapping dialog.

	* app/gui/preferences-dialog.c: added a "Configure Keyboard
	Shortcuts" button which pops up a GimpControllerView. Work in
	progress...
2004-07-20 18:50:20 +00:00
Michael Natterer 28b3fd4a74 reordered and commented to match API docs.
2004-07-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h: reordered and commented to match
	API docs.
2004-07-19 12:08:37 +00:00
Michael Natterer 09c6ee7363 added the removed help IDs back.
2004-07-17  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimphelp-ids.h: added the removed help IDs back.

	* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
	IDs and added gimp_file_proc_view_get_help_id() which returns the
	selected item's help ID.

	* app/widgets/gimpfiledialog.c: added a custom help func which
	shows the help for the selected file_proc if the proc_view has the
	focus.
2004-07-17 19:53:05 +00:00
Sven Neumann d95059db48 use GIMP_STOCK_WEB for "file-open-location".
2004-07-17  Sven Neumann  <sven@gimp.org>

	* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
	for "file-open-location".

	* app/widgets/gimpfiledialog.c: create the scrolled window with
	shadow_type GTK_SHADOW_IN.

	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
	procedures that register a prefix (the URL loader).

	* app/widgets/gimphelp-ids.h: removed help IDs that used to be
	used from the file-open and file-save menus.

	* plug-ins/common/xwd.c (query): "X window dump" seems to be more
	appropriate than "X window image".
2004-07-17 13:06:59 +00:00
Sven Neumann 5222925694 sort the file procedures by their menu labels.
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
	by their menu labels.

	* app/widgets/gimpfileprocview.c: removed the sort function here.
2004-07-16 21:47:06 +00:00
Sven Neumann ccf8ed69e7 app/widgets/Makefile.am app/widgets/widgets-types.h added new widget that
2004-07-16  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
	a treeview on file procedures.

	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
	menu with the new GimpFileProcView widget.
	(gimp_file_dialog_set_image): reset the file type to Automatic
	(fixes bug #141535).

	* app/actions/file-commands.c
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-save-dialog.[ch]: changed accordingly.

	* plug-ins/common/bz2.c
	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
	extension. It's redundant and breaks the code that sets the
	extension from the selected file-type.

	* plug-ins/common/dicom.c: register a shorter menu label.

	* plug-ins/common/gbr.c
	* plug-ins/common/gih.c
	* plug-ins/common/pat.c
	* plug-ins/common/url.c: register stock icons.
2004-07-16 21:24:39 +00:00
Michael Natterer fe9d9be66b Code review & cleanup:
2004-07-14  Michael Natterer  <mitch@gimp.org>

	Code review & cleanup:

	* app/config/gimpguiconfig.[ch]: removed transparency-size,
	transparency-type and snap-distance properties...

	* app/config/gimpdisplayconfig.[ch]: ...and added them here.

	* app/display/gimpdisplayshell.c
	* app/tools/gimpmovetool.c: changed accordingly.

	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
	"max_memsize" parameter instead of looking it up in GimpGuiConfig.

	* app/actions/image-commands.c: changed accordingly.

	* app/core/gimparea.c
	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.

	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
	GimpProjectionIdleRender, reordered functions, cleanup.

	* app/display/gimpdisplay-handlers.c
	* app/display/gimpdisplay.c: removed unused #includes.

	* app/display/gimpdisplayshell.[ch]
	* app/display/gimpdisplayshell-close.c: renamed
	shell->warning_dialog to shell->close_dialog, some random
	cleanups.

	* app/display/gimpdisplayshell-handlers.c
	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-14 10:31:59 +00:00
Michael Natterer 54cc251b08 app/core/Makefile.am app/core/core-types.h new interface which has
2004-07-14  Michael Natterer  <mitch@gimp.org>

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimppickable.[ch]: new interface which has
	get_image_type(), get_tiles() and get_color_at() methods.

	* app/core/gimpdrawable.[ch]
	* app/core/gimpimagemap.[ch]
	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
	and removed public get_colot_at() functions.

	* app/core/gimpimage-pick-color.[ch]: removed typedef
	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
	gimp_pickable_pick_color() instead.

	* app/core/gimpimage-contiguous-region.c
	* app/core/gimpimage-crop.c
	* app/gui/info-window.c
	* app/paint/gimpconvolve.c
	* app/paint/gimpsmudge.c
	* app/tools/gimpbycolorselecttool.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
	instead of the various get_color_at() functions. Simplifies code
	which has a "sample_merged" boolean. Various cleanups.
2004-07-13 23:04:05 +00:00
Michael Natterer c5ec0d4f70 *** empty log message *** 2004-07-13 16:36:29 +00:00
Michael Natterer d41e45b1f4 added a preview of the global buffer.
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpbufferview.[ch]: added a preview of the global
	buffer.
2004-07-12 20:25:05 +00:00
Michael Natterer da74f1269e app/core/gimpundo.[ch] app/core/gimpitemundo.[ch] removed all _new()
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpundo.[ch]
	* app/core/gimpitemundo.[ch]
	* app/text/gimptextundo.[ch]: removed all _new() functions and
	added properties and GObject::constructor() implementations
	instead.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
	"GType undo_gtype" parameter and allow to pass name-value pairs as
	"...". Une the new GParameter utility functions to construct the
	appropriate undo step with g_object_newv().

	(gimp_image_undo_push_item): removed.

	(gimp_image_undo_push_undo): removed. Merged its code back into
	gimp_image_undo_push(), where it originally came from.

	* app/core/gimpimage-undo-push.c
	* app/core/gimpundostack.c
	* app/paint/gimppaintcore-undo.c
	* app/tools/gimptransformtool-undo.c
	* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 16:59:36 +00:00
Michael Natterer 5b83b759d7 set/unset the busy cursor on all windows which have widget->window, not
2004-07-12  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdialogfactory.c
	(gimp_dialog_factories_set_busy_foreach)
	(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
	cursor on all windows which have widget->window, not only for
	those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
	dialogs are hidden while the busy cursor is active and later shown
	again.
2004-07-12 11:47:54 +00:00
Hans Breuer b56eb39ead updated app/actions/makefile.msc app/menus/makefile.msc : (new files)
2004-07-11  Hans Breuer  <hans@breuer.org>

	* **/makefile.msc : updated
	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST

	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
	  app/widgets/gimppropwidgets.c : bumped compiler version check,
	msvc6 still can't cast from unsigned __int64 to double

	* app/actions/debug-actions.c : only use debug_*_callback
	and thus debug_action if ENABLE_DEBUG_MENU

	* app/core/gimpalette-import.c : added gimpwin32-io.h

	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/

	* plug-ins/common/screenshot.c : make it compile with msvc,
	but still no win32 specific implementation ...
2004-07-11 21:53:17 +00:00
Philip Lafleur 3a5019b270 Applied a patch from Robert Robert Ögren, moved here from
2004-07-11  Philip Lafleur  <plafleur@cvs.gnome.org>

	* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied
	a patch from Robert Robert Ögren, moved here from
	toolbox_check_device() - Only change devices if the event came from
	a widget that accepts extension events. Fixes bug #115774.
2004-07-11 03:01:05 +00:00
Michael Natterer 2176afbbbb Removed any remaining GUI dependency from the PDB wrappers:
2004-07-10  Michael Natterer  <mitch@gimp.org>

	Removed any remaining GUI dependency from the PDB wrappers:

	* app/core/gimp.[ch]: added vtable entries for the display and
	help stuff.

	* app/widgets/gimphelp.[ch]: renamed gimp_help() to
	gimp_help_show().

	* app/gui/gui-vtable.c: implement the new display and help vtable
	entries.

	* tools/pdbgen/pdb.pl
	* tools/pdbgen/pdb/display.pdb
	* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
	object instead of using stuff from display/ and widgets/.

	* tools/pdbgen/app.pl: removed bad hacks which enabled including
	stuff from gui/, display/ and widgets/.

	* app/Makefile.am: link widgets-enums.o, display-enums.o and
	gimpdisplayoptions.o into the gimp-console binary because they are
	needed for the config system and don't depend on any GUI stuff.

	* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/

	* app/pdb/display_cmds.c
	* app/pdb/help_cmds.c: regenerated.
2004-07-10 20:29:11 +00:00
Michael Natterer 8d9e362249 app/gui/Makefile.am app/gui/brush-select.[ch] app/gui/font-select.[ch]
2004-07-09  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/brush-select.[ch]
	* app/gui/font-select.[ch]
	* app/gui/gradient-select.[ch]
	* app/gui/palette-select.[ch]
	* app/gui/pattern-select.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimppdbdialog.[ch]
	* app/widgets/gimpdataselect.[ch]
	* app/widgets/gimpbrushselect.[ch]
	* app/widgets/gimpgradientselect.[ch]
	* app/widgets/gimppaletteselect.[ch]
	* app/widgets/gimppatternselect.[ch]
	* app/widgets/gimpfontselect.[ch]: ...and added here as a
	hierarchy of widgets.

	* app/widgets/gimpdatafactoryview.h: removed typdef
	GimpDataEditFunc, it's in widgets-types.h now.

	* app/gui/convert-dialog.c: changed accordingly.

	* app/core/gimp.[ch]: added vtable entries for creating, closing
	and setting PDB dialogs.

	* app/gui/gui-vtable.c: implement the vtable entries using the new
	widgets.

	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
	the Gimp object to create / manage the selection dialogs. The
	generated files don't depend on GUI stuff any longer.

	* app/pdb/brush_select_cmds.c
	* app/pdb/font_select_cmds.c
	* app/pdb/gradient_select_cmds.c
	* app/pdb/palette_select_cmds.c
	* app/pdb/pattern_select_cmds.c: regenerated.
2004-07-09 19:14:59 +00:00
Sven Neumann 458ea9a50e reverted my last change. (gimp_histogram_editor_item_visible): fix the
2004-07-09  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): reverted my last change.
	(gimp_histogram_editor_item_visible): fix the problem here instead.
2004-07-08 22:45:36 +00:00
Michael Natterer 788ae2fd5f removed "role" property because GtkWindow has an equivalent property now.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpdialog.c: removed "role" property because
	GtkWindow has an equivalent property now. Added "help-func" and
	"help-id" construct properties.

	* app/widgets/gimptexteditor.c
	* app/widgets/gimptooldialog.c
	* app/widgets/gimpviewabledialog.c: removed calls to
	gimp_help_connect() and pass help_func and help_id to
	g_object_new().
2004-07-08 21:57:05 +00:00
Sven Neumann 1746c311e7 set the active item of the combo-box after changing the visibility filter.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogrameditor.c
	(gimp_histogram_editor_menu_update): set the active item of the
	combo-box after changing the visibility filter.
2004-07-08 13:23:27 +00:00
Michael Natterer c8d9457f07 same fix as below.
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
	same fix as below.
2004-07-08 13:17:06 +00:00
Sven Neumann 822db32134 block gimp_prop_enum_combo_box_callback() before changing the combo-box.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
	block gimp_prop_enum_combo_box_callback() before changing the
	combo-box.
2004-07-08 12:50:15 +00:00
Sven Neumann 8bc46f69f3 only write aux-info for properties that have been changed from their
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpsessioninfo.c: only write aux-info for properties
	that have been changed from their default values.

	* app/widgets/gimphistogrameditor.c: some code cleanup.
2004-07-08 12:04:15 +00:00
Michael Natterer d18097028e added a "const gchar *format" parameter to
2004-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
	parameter to gimp_selection_data_set_pixbuf() which selects the
	format in which to encode the pixbuf (was defaulting to "png"
	before).

	* app/widgets/gimpclipboard.c: when copying, offer all formats which
	are savable with GdkPixbuf. Added a GimpClipboard struct which is
	attached to the Gimp and which stores all the persistent data
	needed by the clipboard. Renamed some private functions.

	(unfortunately this change breaks pasting to AbiWord:
	 http://bugzilla.abisource.com/show_bug.cgi?id=7068)
2004-07-08 11:27:48 +00:00
Sven Neumann a4ac4de072 app/config/gimpconfig-deserialize.c removed redundant casts.
2004-07-08  Sven Neumann  <sven@gimp.org>

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-serialize.c: removed redundant casts.

	* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
	get and set aux-info based on object properties.

	* app/widgets/gimphistogrameditor.c: use the new functions to save
	a histogram's channel and scale in the sessionrc.
2004-07-08 00:09:41 +00:00
Sven Neumann 73b1182c80 sort the list of pixbuf formats so that PNG is the preferred format and
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
	that PNG is the preferred format and GIF and JPEG come last.
2004-07-07 18:09:14 +00:00
Michael Natterer 94163a8beb changed to allow pasting any GdkPixbuf supported format (makes pasting
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
	GdkPixbuf supported format (makes pasting from OpenOffice
	work). Cleaned up a bit to perpare pasting of SVG data.
2004-07-07 16:02:23 +00:00
Michael Natterer 8fc8cb487c app/gui/Makefile.am removed...
2004-07-07  Michael Natterer  <mitch@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: removed...

	* app/widgets/Makefile.am
	* app/widgets/gimpclipboard.[ch]: ...and added here.

	* app/actions/edit-commands.c
	* app/gui/gui.c: changed accordingly.
2004-07-07 14:38:23 +00:00
Sven Neumann 2d412472c2 fixed a drawing bug I introduced earlier today.
2004-07-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
	fixed a drawing bug I introduced earlier today.
2004-07-07 01:59:33 +00:00
Sven Neumann ef885f7691 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes bug
2004-07-06  Sven Neumann  <sven@gimp.org>

	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
	bug #145401.

	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
	it to the PDB.

	* app/base/gimphistogram.c: implemented histogram functions for
	the RGB mode.

	* app/base/levels.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimplevelstool.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimphistogrameditor.c: handle the new enum value.

	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
	draw a histogram that shows the RGB channels simultaneously
2004-07-06 16:33:30 +00:00
Michael Natterer fa668df1ee call gtk_menu_set_monitor() only for GTK+ < 2.4.4 and added a #warning
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
	(gimp_button_menu_position): call gtk_menu_set_monitor() only
	for GTK+ < 2.4.4 and added a #warning about it.
2004-07-06 15:05:47 +00:00
Michael Natterer 3b7fc27b5e queue an idle update when setting the viewable to NULL so the view gets
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimppreviewrenderer.c
	(gimp_preview_renderer_set_viewable): queue an idle update when
	setting the viewable to NULL so the view gets cleared correctly.

	(gimp_preview_renderer_idle_update): call
	gimp_preview_renderer_update() even if renderer->viewable is NULL
	so clearing the viewable gets propagated to the GUI.

	Moved clearing the viewable and removing the idle from
	GObject::finalize() to GObject::dispose() because calling
	set_viewable() with a NULL viewable triggers typechecking casts
	and queuing idle functions, which is not nice in finalize().
2004-07-06 13:18:42 +00:00
Sven Neumann d5724ff596 return the proper type.
2004-07-06  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
	return the proper type.
2004-07-06 10:54:46 +00:00
Michael Natterer 960c32e94a connect to "editing-canceled" of the name cell renderer and restore the
2004-07-06  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.c: connect to
	"editing-canceled" of the name cell renderer and restore the
	original text in the callback. Doesn't work reliably until GTK+
	bug #145463 is fixed.
2004-07-05 22:50:38 +00:00
Michael Natterer 49a46c76a0 removed unused local variables.
2004-07-05  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptemplateview.c
	(gimp_template_view_tree_name_edited): removed unused local variables.
2004-07-05 14:57:22 +00:00
Simon Budig e7af53b0d3 app/actions/dialogs-commands.c app/display/gimpdisplayshell-dnd.c
2004-07-04  Simon Budig  <simon@gimp.org>

	* app/actions/dialogs-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/preferences-dialog.c
	* app/tools/gimppainttool.c
	* app/widgets/gimpdeviceinfo.c
	* app/widgets/gimpitemtreeview.c
	* plug-ins/imagemap/imap_selection.c
	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
	CVS compile with gcc 2.95 again. Mostly double semicolons and
	variable declarations after other stuff. Spotted by Martin
	Renold.

	* app/pdb/gradients_cmds.c: regenerated.

	(there is one issue left, see his patch at
	http://old.homeip.net/martin/gcc-2.95.diff, I did not
	copy the #define va_copy __va_copy, since I don't know
	what happens here.)
2004-07-04 21:27:09 +00:00
Sven Neumann 21fea37da7 modules/cdisplay_gamma.c added object properties for configurable values.
2004-07-04  Sven Neumann  <sven@gimp.org>

	* modules/cdisplay_gamma.c
	* modules/cdisplay_highcontrast.c: added object properties for
	configurable values.

	* app/widgets/gimpcolordisplayeditor.c
	* libgimpwidgets/gimpcolordisplaystack.c
	* modules/cdisplay_colorblind.c
	* modules/cdisplay_proof.c: cosmetic changes.
2004-07-04 00:21:03 +00:00
Michael Natterer 23f6a194ac added context->serialize_props mask which enables specifying exactly which
2004-07-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpcontext.[ch]: added context->serialize_props mask
	which enables specifying exactly which properties will be
	serialized. Also fixes a bug that prevented undefined properties
	from being serialized, breaking tool_options and device status
	serialization.

	* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
	properties in the tool_info->context_props mask serializable, also
	configure/initialize tool_info->tool_options.

	* app/tools/gimp-tools.c (gimp_tools_register): removed
	tool_options initialization that is now done in
	gimp_tool_info_new().

	* app/widgets/gimpdeviceinfo.c: make only the properties in
	GIMP_DEVICE_INFO_CONTEXT_MASK serializable.

	* app/widgets/gimpdevicestatus.c: add the device table to its
	parent container again. Fixes "missing" devices.

	* app/core/gimptooloptions.c
	* app/widgets/gimpdevices.c: cleanup / code review.
2004-07-03 20:27:28 +00:00
Sven Neumann 6423529b86 app/gui/Makefile.am new files implementing a clipboard for image data
2004-07-02  Sven Neumann  <sven@gimp.org>

	* app/gui/Makefile.am
	* app/gui/clipboard.[ch]: new files implementing a clipboard for
	image data based on GDK_SELECTION_CLIPBOARD (bug #133247).

	* app/actions/edit-actions.c
	* app/actions/edit-commands.c: use the new clipboard API.

	* app/gui/gui.c: initialize and shutdown the clipboard.

	* app/core/gimpbuffer.c: cosmetics.

	* app/actions/actions.c
	* app/menus/menus.c: added sanity checks to exit functions.

	* app/display/gimpdisplayshell-dnd.[ch]: let
	gimp_display_shell_drop_svg() take a guchar * buffer.

	* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
	fixed the implementation.
2004-07-02 14:08:15 +00:00
Sven Neumann 931110de27 added (yet unused) functions gimp_selection_data_[get|set]_pixbuf().
2004-07-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
	gimp_selection_data_[get|set]_pixbuf().
2004-07-01 15:46:25 +00:00
Michael Natterer 6679dc7183 implement GtkWidget::drag_motion() and set the FG/BG depending on where
2004-07-01  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
	and set the FG/BG depending on where the color was dropped. Also
	set the drag status accordingly so the cursor indicates whether
	dropping will have an effect or not. Fixes bug #145219.
2004-07-01 10:42:00 +00:00
Sven Neumann bec9f9a670 app/core/core-enums.c app/display/display-enums.c app/paint/paint-enums.c
2004-06-30  Sven Neumann  <sven@gimp.org>

	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-06-30 16:05:24 +00:00
William Skaggs 8d4bdf5d60 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/*/*-enums.h: did HIG-compliant capitalization in the right
	place, instead of the auto-generated *-enums.c files.
2004-06-30 15:47:32 +00:00
Michael Natterer cc6aa18619 app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpselectiondata.[ch]
	* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
	to "uri_list" in all function names, parameters and typedefs.

	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/display/gimpdisplayshell.c: changed accordingly.
2004-06-30 14:47:23 +00:00
Michael Natterer 4022980314 Fixed a 1.2 -> 2.0 regression that was forgotten:
2004-06-30  Michael Natterer  <mitch@gimp.org>

	Fixed a 1.2 -> 2.0 regression that was forgotten:

	* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
	which can be one of { NEW, UPDATE }.

	* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
	gimp_palette_editor_update_color() to
	gimp_palette_editor_pick_color() and restored the functionality of
	creating/updating colors via this API

	Changed button_press handler to only edit the color on double
	click if it's really a double click on the same color.
	Fixes bug #141381.

	* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
	"add-to-palette" and a GUI for it.

	* app/core/gimpmarshal.list
	* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
	parameter to the "color_picked" signal. Pass NEW on button_press
	and UPDATE on motion.

	* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
	* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
	* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
	changed accordingly

	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
	If "add-to-palette" is TRUE, get the palette editor and call
	gimp_palette_editor_pick_color().
2004-06-30 12:10:08 +00:00
Sven Neumann 114f747f4c renamed the SVG related functions so that they deal with an anonymous data
2004-06-30  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
	functions so that they deal with an anonymous data stream that
	could as well be a PNG image.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.

	* app/display/gimpdisplayshell-dnd.[ch]
	* app/vectors/gimpvectors-import.[ch]
	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpvectorstreeview.c: use gsize for the length of
	the buffer.

	* app/widgets/gimpdnd.[ch]
	* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
	used yet.
2004-06-30 11:57:17 +00:00
Michael Natterer 425fd699e3 changed return value from gchar* to const gchar*. Renamed parameters to be
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
	changed return value from gchar* to const gchar*. Renamed
	parameters to be consistent with other SVG functions.

	* widgets/gimpcontainertreeview-dnd.c
	* widgets/gimpdnd.c: changed accordingly.
2004-06-29 23:18:18 +00:00
Michael Natterer 3cec641627 do like GtkAccelLabel does and turn underscores in accels into spaces so
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
	do like GtkAccelLabel does and turn underscores in accels into
	spaces so e.g. "Page_Up" becomes "Page Up".
2004-06-29 22:35:04 +00:00
Michael Natterer 4685112cff reordered drop destinations so vectors are preferred over SVG.
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell.c: reordered drop destinations
	so vectors are preferred over SVG.

	* app/vectors/gimpvectors-import.[ch]: added "gint position"
	parameter to all import functions so the imported vectors can be
	added at any position in the vectors stack.

	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell-dnd.c
	* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
	position).

	* app/pdb/paths_cmds.c: regenerated.

	* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
	to the paths dialog.
2004-06-29 13:34:16 +00:00
Michael Natterer 03b4c71d69 don't free the SVG data after dropping, it's owned by GtkSelectionData.
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
	after dropping, it's owned by GtkSelectionData.
2004-06-29 13:28:26 +00:00
Michael Natterer 3f5e10c1d6 use gtk_target_list_add() instead of gtk_target_list_add_table() because
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
	gtk_target_list_add_table() because the latter prepends the
	targets to the internal list which screws the order (== priority)
	of DND targets.

	* app/widgets/gimpselectiondata.c: added some more checks for
	failed drops (selection_data->length < 0).
2004-06-29 13:20:30 +00:00
Michael Natterer 6cd5737257 added new function gimp_get_mod_string() which takes a GdkModifierType and
2004-06-29  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: added new function
	gimp_get_mod_string() which takes a GdkModifierType and returns
	correctly formated strings for all shift,control,alt combinations.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpconvolvetool.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpdodgeburntool.c
	* app/tools/gimperasertool.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimperrorconsole.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimppaletteeditor.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: use the new function instead
	of gimp_get_mod_name_shift(),control(),alt(),separator(). This
	kindof addresses the issue of configurable modifier keys but is
	actually indended to ease translation of format strings ("%s" is
	easier to get right than "%s%s%s").
2004-06-28 23:30:57 +00:00