gimp/app/widgets/gimpfiledialog.c

835 lines
26 KiB
C
Raw Normal View History

/* The GIMP -- an image manipulation program
* Copyright (C) 1995 Spencer Kimball and Peter Mattis
*
* gimpfiledialog.c
* Copyright (C) 2004 Michael Natterer <mitch@gimp.org>
*
* This program is free software; you can redistribute it and/or modify
* it under the terms of the GNU General Public License as published by
* the Free Software Foundation; either version 2 of the License, or
* (at your option) any later version.
*
* This program is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
* GNU General Public License for more details.
*
* You should have received a copy of the GNU General Public License
* along with this program; if not, write to the Free Software
* Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
*/
#include "config.h"
#include <string.h>
#include <gtk/gtk.h>
#include "libgimpwidgets/gimpwidgets.h"
#include "widgets-types.h"
#include "core/gimp.h"
#include "core/gimpimage.h"
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
#include "core/gimpprogress.h"
#include "config/gimpcoreconfig.h"
#include "config/gimpguiconfig.h"
#include "pdb/procedural_db.h" /* FIXME */
#include "file/file-utils.h"
#include "plug-in/plug-in-proc-def.h"
#include "plug-in/plug-ins.h"
#include "gimpfiledialog.h"
#include "gimpfileprocview.h"
#include "gimphelp-ids.h"
#include "gimpmessagebox.h"
#include "gimpmessagedialog.h"
#include "gimpview.h"
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 22:20:30 +08:00
#include "gimpviewrendererimagefile.h"
#include "gimpthumbbox.h"
#include "gimpwidgets-utils.h"
#include "gimp-intl.h"
static void gimp_file_dialog_class_init (GimpFileDialogClass *klass);
static void gimp_file_dialog_progress_iface_init (GimpProgressInterface *progress_iface);
static gboolean gimp_file_dialog_delete_event (GtkWidget *widget,
GdkEventAny *event);
static void gimp_file_dialog_response (GtkDialog *dialog,
gint response_id);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
static GimpProgress *
gimp_file_dialog_progress_start (GimpProgress *progress,
const gchar *message,
gboolean cancelable);
static void gimp_file_dialog_progress_end (GimpProgress *progress);
static gboolean gimp_file_dialog_progress_is_active (GimpProgress *progress);
static void gimp_file_dialog_progress_set_text (GimpProgress *progress,
const gchar *message);
static void gimp_file_dialog_progress_set_value (GimpProgress *progress,
gdouble percentage);
static gdouble gimp_file_dialog_progress_get_value (GimpProgress *progress);
static void gimp_file_dialog_progress_pulse (GimpProgress *progress);
static void gimp_file_dialog_add_preview (GimpFileDialog *dialog,
Gimp *gimp);
static void gimp_file_dialog_add_filters (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs);
static void gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs,
const gchar *automatic,
const gchar *automatic_help_id);
static void gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
GimpFileDialog *dialog);
static void gimp_file_dialog_update_preview (GtkFileChooser *chooser,
GimpFileDialog *dialog);
static void gimp_file_dialog_proc_changed (GimpFileProcView *view,
GimpFileDialog *dialog);
static void gimp_file_dialog_help_func (const gchar *help_id,
gpointer help_data);
static void gimp_file_dialog_help_clicked (GtkWidget *widget,
gpointer dialog);
static gchar * gimp_file_dialog_pattern_from_extension (const gchar *extension);
GType
gimp_file_dialog_get_type (void)
{
static GType dialog_type = 0;
if (! dialog_type)
{
static const GTypeInfo dialog_info =
{
sizeof (GimpFileDialogClass),
(GBaseInitFunc) NULL,
(GBaseFinalizeFunc) NULL,
(GClassInitFunc) gimp_file_dialog_class_init,
NULL, /* class_finalize */
NULL, /* class_data */
sizeof (GimpFileDialog),
0, /* n_preallocs */
NULL, /* instance_init */
};
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
static const GInterfaceInfo progress_iface_info =
{
(GInterfaceInitFunc) gimp_file_dialog_progress_iface_init,
NULL, /* iface_finalize */
NULL /* iface_data */
};
dialog_type = g_type_register_static (GTK_TYPE_FILE_CHOOSER_DIALOG,
"GimpFileDialog",
&dialog_info, 0);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
g_type_add_interface_static (dialog_type, GIMP_TYPE_PROGRESS,
&progress_iface_info);
}
return dialog_type;
}
static void
gimp_file_dialog_class_init (GimpFileDialogClass *klass)
{
GtkWidgetClass *widget_class = GTK_WIDGET_CLASS (klass);
GtkDialogClass *dialog_class = GTK_DIALOG_CLASS (klass);
widget_class->delete_event = gimp_file_dialog_delete_event;
dialog_class->response = gimp_file_dialog_response;
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
static void
gimp_file_dialog_progress_iface_init (GimpProgressInterface *progress_iface)
{
progress_iface->start = gimp_file_dialog_progress_start;
progress_iface->end = gimp_file_dialog_progress_end;
progress_iface->is_active = gimp_file_dialog_progress_is_active;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
progress_iface->set_text = gimp_file_dialog_progress_set_text;
progress_iface->set_value = gimp_file_dialog_progress_set_value;
progress_iface->get_value = gimp_file_dialog_progress_get_value;
progress_iface->pulse = gimp_file_dialog_progress_pulse;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
}
static gboolean
gimp_file_dialog_delete_event (GtkWidget *widget,
GdkEventAny *event)
{
return TRUE;
}
static void
gimp_file_dialog_response (GtkDialog *dialog,
gint response_id)
{
GimpFileDialog *file_dialog = GIMP_FILE_DIALOG (dialog);
if (response_id != GTK_RESPONSE_OK && file_dialog->busy)
{
file_dialog->canceled = TRUE;
if (file_dialog->progress_active && file_dialog->progress_cancelable)
gimp_progress_cancel (GIMP_PROGRESS (dialog));
}
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
static GimpProgress *
gimp_file_dialog_progress_start (GimpProgress *progress,
const gchar *message,
gboolean cancelable)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (! dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
gtk_progress_bar_set_text (bar, message);
gtk_progress_bar_set_fraction (bar, 0.0);
gtk_widget_show (dialog->progress);
dialog->progress_active = TRUE;
dialog->progress_cancelable = cancelable;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
return progress;
}
return NULL;
}
static void
gimp_file_dialog_progress_end (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
gtk_progress_bar_set_text (bar, "");
gtk_progress_bar_set_fraction (bar, 0.0);
gtk_widget_hide (dialog->progress);
dialog->progress_active = FALSE;
dialog->progress_cancelable = FALSE;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
}
}
static gboolean
gimp_file_dialog_progress_is_active (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
return dialog->progress_active;
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
static void
gimp_file_dialog_progress_set_text (GimpProgress *progress,
const gchar *message)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
gtk_progress_bar_set_text (bar, message);
}
}
static void
gimp_file_dialog_progress_set_value (GimpProgress *progress,
gdouble percentage)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
gtk_progress_bar_set_fraction (bar, percentage);
}
}
static gdouble
gimp_file_dialog_progress_get_value (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
return gtk_progress_bar_get_fraction (bar);
}
return 0.0;
}
static void
gimp_file_dialog_progress_pulse (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
if (dialog->progress_active)
{
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
gtk_progress_bar_pulse (bar);
}
}
/* public functions */
GtkWidget *
gimp_file_dialog_new (Gimp *gimp,
GtkFileChooserAction action,
const gchar *title,
const gchar *role,
const gchar *stock_id,
const gchar *help_id)
{
GimpFileDialog *dialog;
GSList *file_procs;
const gchar *automatic;
const gchar *automatic_help_id;
gboolean local_only;
g_return_val_if_fail (GIMP_IS_GIMP (gimp), NULL);
g_return_val_if_fail (title != NULL, NULL);
g_return_val_if_fail (role != NULL, NULL);
g_return_val_if_fail (stock_id != NULL, NULL);
g_return_val_if_fail (help_id != NULL, NULL);
switch (action)
{
case GTK_FILE_CHOOSER_ACTION_OPEN:
file_procs = gimp->load_procs;
automatic = _("Automatically Detected");
automatic_help_id = GIMP_HELP_FILE_OPEN_BY_EXTENSION;
/* FIXME */
local_only = (procedural_db_lookup (gimp, "file_uri_load") == NULL);
break;
case GTK_FILE_CHOOSER_ACTION_SAVE:
file_procs = gimp->save_procs;
automatic = _("By Extension");
automatic_help_id = GIMP_HELP_FILE_SAVE_BY_EXTENSION;
/* FIXME */
local_only = (procedural_db_lookup (gimp, "file_uri_save") == NULL);
break;
default:
g_return_val_if_reached (NULL);
return NULL;
}
dialog = g_object_new (GIMP_TYPE_FILE_DIALOG,
"title", title,
"role", role,
"action", action,
"local-only", local_only,
NULL);
gtk_dialog_add_buttons (GTK_DIALOG (dialog),
GTK_STOCK_CANCEL, GTK_RESPONSE_CANCEL,
stock_id, GTK_RESPONSE_OK,
NULL);
gtk_dialog_set_default_response (GTK_DIALOG (dialog), GTK_RESPONSE_OK);
gimp_help_connect (GTK_WIDGET (dialog),
gimp_file_dialog_help_func, help_id, dialog);
if (GIMP_GUI_CONFIG (gimp->config)->show_help_button && help_id)
{
GtkWidget *action_area = GTK_DIALOG (dialog)->action_area;
GtkWidget *button = gtk_button_new_from_stock (GTK_STOCK_HELP);
gtk_box_pack_end (GTK_BOX (action_area), button, FALSE, TRUE, 0);
gtk_button_box_set_child_secondary (GTK_BUTTON_BOX (action_area),
button, TRUE);
gtk_widget_show (button);
g_object_set_data_full (G_OBJECT (dialog), "gimp-dialog-help-id",
g_strdup (help_id),
(GDestroyNotify) g_free);
g_signal_connect (button, "clicked",
G_CALLBACK (gimp_file_dialog_help_clicked),
dialog);
g_object_set_data (G_OBJECT (dialog), "gimp-dialog-help-button", button);
}
gimp_file_dialog_add_preview (dialog, gimp);
gimp_file_dialog_add_filters (dialog, gimp, file_procs);
gimp_file_dialog_add_proc_selection (dialog, gimp, file_procs, automatic,
automatic_help_id);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-11 02:47:21 +08:00
dialog->progress = gtk_progress_bar_new ();
gtk_box_pack_end (GTK_BOX (GTK_DIALOG (dialog)->vbox), dialog->progress,
FALSE, FALSE, 0);
return GTK_WIDGET (dialog);
}
void
gimp_file_dialog_set_sensitive (GimpFileDialog *dialog,
gboolean sensitive)
{
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
gimp_dialog_set_sensitive (GTK_DIALOG (dialog), sensitive);
dialog->busy = ! sensitive;
dialog->canceled = FALSE;
}
void
gimp_file_dialog_set_file_proc (GimpFileDialog *dialog,
PlugInProcDef *file_proc)
{
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
if (file_proc != dialog->file_proc)
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view),
file_proc);
}
void
gimp_file_dialog_set_image (GimpFileDialog *dialog,
GimpImage *gimage,
gboolean save_a_copy)
{
const gchar *uri = NULL;
gboolean uri_set = FALSE;
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
g_return_if_fail (GIMP_IS_IMAGE (gimage));
dialog->gimage = gimage;
dialog->save_a_copy = save_a_copy;
if (save_a_copy)
uri = g_object_get_data (G_OBJECT (gimage), "gimp-image-save-a-copy");
if (! uri)
uri = gimp_object_get_name (GIMP_OBJECT (gimage));
if (uri)
uri_set = gtk_file_chooser_set_uri (GTK_FILE_CHOOSER (dialog), uri);
gimp_file_dialog_set_file_proc (dialog, NULL);
if (! uri_set)
{
const gchar *name = gimp_image_get_uri (gimage);
gchar *current;
if (! name)
name = "";
current = g_path_get_basename (name);
gtk_file_chooser_set_current_name (GTK_FILE_CHOOSER (dialog), current);
g_free (current);
}
}
gboolean
gimp_file_overwrite_dialog (GtkWidget *parent,
const gchar *uri)
{
GtkWidget *dialog;
gchar *filename;
gboolean overwrite = FALSE;
dialog = gimp_message_dialog_new (_("File exists"), GIMP_STOCK_WARNING,
parent, GTK_DIALOG_DESTROY_WITH_PARENT,
gimp_standard_help_func, NULL,
GTK_STOCK_CANCEL, GTK_RESPONSE_CANCEL,
_("_Replace"), GTK_RESPONSE_OK,
NULL);
gtk_dialog_set_alternative_button_order (GTK_DIALOG (dialog),
GTK_RESPONSE_OK,
GTK_RESPONSE_CANCEL,
-1);
filename = file_utils_uri_to_utf8_filename (uri);
gimp_message_box_set_primary_text (GIMP_MESSAGE_DIALOG (dialog)->box,
_("A file named '%s' already exists."),
filename);
g_free (filename);
gimp_message_box_set_text (GIMP_MESSAGE_DIALOG (dialog)->box,
_("Do you want to replace it with the image "
"you are saving?"));
if (GTK_IS_DIALOG (parent))
gtk_dialog_set_response_sensitive (GTK_DIALOG (parent),
GTK_RESPONSE_CANCEL, FALSE);
g_object_ref (dialog);
overwrite = (gimp_dialog_run (GIMP_DIALOG (dialog)) == GTK_RESPONSE_OK);
gtk_widget_destroy (dialog);
g_object_unref (dialog);
if (GTK_IS_DIALOG (parent))
gtk_dialog_set_response_sensitive (GTK_DIALOG (parent),
GTK_RESPONSE_CANCEL, TRUE);
return overwrite;
}
/* private functions */
static void
gimp_file_dialog_add_preview (GimpFileDialog *dialog,
Gimp *gimp)
{
if (gimp->config->thumbnail_size <= 0)
return;
gtk_file_chooser_set_use_preview_label (GTK_FILE_CHOOSER (dialog), FALSE);
g_signal_connect (dialog, "selection-changed",
G_CALLBACK (gimp_file_dialog_selection_changed),
dialog);
g_signal_connect (dialog, "update-preview",
G_CALLBACK (gimp_file_dialog_update_preview),
dialog);
dialog->thumb_box = gimp_thumb_box_new (gimp);
gtk_widget_set_sensitive (GTK_WIDGET (dialog->thumb_box), FALSE);
gtk_file_chooser_set_preview_widget (GTK_FILE_CHOOSER (dialog),
dialog->thumb_box);
gtk_widget_show (dialog->thumb_box);
#ifdef ENABLE_FILE_SYSTEM_ICONS
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 22:20:30 +08:00
GIMP_VIEW_RENDERER_IMAGEFILE (GIMP_VIEW (GIMP_THUMB_BOX (dialog->thumb_box)->preview)->renderer)->file_system = _gtk_file_chooser_get_file_system (GTK_FILE_CHOOSER (dialog));
#endif
}
static void
gimp_file_dialog_add_filters (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs)
{
GtkFileFilter *all;
GSList *list;
all = gtk_file_filter_new ();
gtk_file_filter_set_name (all, _("All Files"));
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), all);
gtk_file_filter_add_pattern (all, "*");
all = gtk_file_filter_new ();
gtk_file_filter_set_name (all, _("All Images"));
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), all);
for (list = file_procs; list; list = g_slist_next (list))
{
PlugInProcDef *file_proc = list->data;
if (file_proc->extensions_list)
{
GtkFileFilter *filter = gtk_file_filter_new ();
const gchar *domain;
gchar *label;
GString *str;
GSList *ext;
gint i;
domain = plug_ins_locale_domain (gimp, file_proc->prog, NULL);
label = plug_in_proc_def_get_label (file_proc, domain);
str = g_string_new (label);
g_free (label);
/* an arbitrary limit to keep the file dialog from becoming too wide */
#define MAX_EXTENSIONS 4
for (ext = file_proc->extensions_list, i = 0;
ext;
ext = g_slist_next (ext), i++)
{
const gchar *extension = ext->data;
gchar *pattern;
pattern = gimp_file_dialog_pattern_from_extension (extension);
gtk_file_filter_add_pattern (filter, pattern);
gtk_file_filter_add_pattern (all, pattern);
g_free (pattern);
if (i == 0)
{
g_string_append (str, " (");
}
else if (i <= MAX_EXTENSIONS)
{
g_string_append (str, ", ");
}
if (i < MAX_EXTENSIONS)
{
g_string_append (str, "*.");
g_string_append (str, extension);
}
else if (i == MAX_EXTENSIONS)
{
g_string_append (str, "...");
}
if (! ext->next)
{
g_string_append (str, ")");
}
}
gtk_file_filter_set_name (filter, str->str);
g_string_free (str, TRUE);
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), filter);
}
}
gtk_file_chooser_set_filter (GTK_FILE_CHOOSER (dialog), all);
}
static void
gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs,
const gchar *automatic,
const gchar *automatic_help_id)
{
GtkWidget *scrolled_window;
dialog->proc_expander = gtk_expander_new_with_mnemonic (NULL);
gtk_file_chooser_set_extra_widget (GTK_FILE_CHOOSER (dialog),
dialog->proc_expander);
gtk_widget_show (dialog->proc_expander);
scrolled_window = gtk_scrolled_window_new (NULL, NULL);
gtk_scrolled_window_set_policy (GTK_SCROLLED_WINDOW (scrolled_window),
GTK_POLICY_AUTOMATIC, GTK_POLICY_AUTOMATIC);
gtk_scrolled_window_set_shadow_type (GTK_SCROLLED_WINDOW (scrolled_window),
GTK_SHADOW_IN);
gtk_container_add (GTK_CONTAINER (dialog->proc_expander), scrolled_window);
gtk_widget_show (scrolled_window);
gtk_widget_set_size_request (scrolled_window, -1, 200);
dialog->proc_view = gimp_file_proc_view_new (gimp, file_procs, automatic,
automatic_help_id);
gtk_container_add (GTK_CONTAINER (scrolled_window), dialog->proc_view);
gtk_widget_show (dialog->proc_view);
g_signal_connect (dialog->proc_view, "changed",
G_CALLBACK (gimp_file_dialog_proc_changed),
dialog);
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view), NULL);
}
static void
gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
GimpFileDialog *dialog)
{
gimp_thumb_box_take_uris (GIMP_THUMB_BOX (dialog->thumb_box),
gtk_file_chooser_get_uris (chooser));
}
static void
gimp_file_dialog_update_preview (GtkFileChooser *chooser,
GimpFileDialog *dialog)
{
gchar *uri = gtk_file_chooser_get_preview_uri (chooser);
gimp_thumb_box_set_uri (GIMP_THUMB_BOX (dialog->thumb_box), uri);
g_free (uri);
}
static void
gimp_file_dialog_proc_changed (GimpFileProcView *view,
GimpFileDialog *dialog)
{
GtkFileChooser *chooser = GTK_FILE_CHOOSER (dialog);
gchar *name;
dialog->file_proc = gimp_file_proc_view_get_proc (view, &name);
if (name)
{
gchar *label = g_strdup_printf (_("Select File _Type (%s)"), name);
gtk_expander_set_label (GTK_EXPANDER (dialog->proc_expander), label);
g_free (label);
g_free (name);
}
if (gtk_file_chooser_get_action (chooser) == GTK_FILE_CHOOSER_ACTION_SAVE)
{
PlugInProcDef *proc = dialog->file_proc;
if (proc && proc->extensions_list)
{
gchar *uri = gtk_file_chooser_get_uri (chooser);
if (uri && strlen (uri))
{
const gchar *last_dot = strrchr (uri, '.');
/* check if the uri has a "meta extension" (e.g. foo.bar.gz)
* and try to truncate both extensions away.
*/
if (last_dot && last_dot != uri)
{
GList *list;
for (list = view->meta_extensions;
list;
list = g_list_next (list))
{
const gchar *ext = list->data;
if (! strcmp (ext, last_dot + 1))
{
const gchar *p = last_dot - 1;
while (p > uri && *p != '.')
p--;
if (p != uri && *p == '.')
{
last_dot = p;
break;
}
}
}
}
if (last_dot != uri)
{
GString *s = g_string_new (uri);
gchar *basename;
if (last_dot)
g_string_truncate (s, last_dot - uri);
g_string_append (s, ".");
g_string_append (s, (gchar *) proc->extensions_list->data);
gtk_file_chooser_set_uri (chooser, s->str);
basename = file_utils_uri_to_utf8_basename (s->str);
gtk_file_chooser_set_current_name (chooser, basename);
g_free (basename);
g_string_free (s, TRUE);
}
}
g_free (uri);
}
}
}
static void
gimp_file_dialog_help_func (const gchar *help_id,
gpointer help_data)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (help_data);
GtkWidget *focus;
focus = gtk_window_get_focus (GTK_WINDOW (dialog));
if (focus == dialog->proc_view)
{
gchar *proc_help_id;
proc_help_id =
gimp_file_proc_view_get_help_id (GIMP_FILE_PROC_VIEW (dialog->proc_view));
gimp_standard_help_func (proc_help_id, NULL);
g_free (proc_help_id);
}
else
{
gimp_standard_help_func (help_id, NULL);
}
}
static void
gimp_file_dialog_help_clicked (GtkWidget *widget,
gpointer dialog)
{
gimp_standard_help_func (g_object_get_data (dialog, "gimp-dialog-help-id"),
NULL);
}
static gchar *
gimp_file_dialog_pattern_from_extension (const gchar *extension)
{
gchar *pattern;
gchar *p;
gint len, i;
g_return_val_if_fail (extension != NULL, NULL);
/* This function assumes that file extensions are 7bit ASCII. It
* could certainly be rewritten to handle UTF-8 if this assumption
* turns out to be incorrect.
*/
len = strlen (extension);
pattern = g_new (gchar, 4 + 4 * len);
strcpy (pattern, "*.");
for (i = 0, p = pattern + 2; i < len; i++, p+= 4)
{
p[0] = '[';
p[1] = g_ascii_tolower (extension[i]);
p[2] = g_ascii_toupper (extension[i]);
p[3] = ']';
}
*p = '\0';
return pattern;
}